KEGG   Cynoglossus semilaevis (tongue sole): 103385492Help
Entry
103385492         CDS       T04866                                 

Definition
(RefSeq) monoacylglycerol lipase ABHD6-like
  KO
K13700  abhydrolase domain-containing protein 6 [EC:3.1.1.23]
Organism
csem  Cynoglossus semilaevis (tongue sole)
Brite
KEGG Orthology (KO) [BR:csem00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:csem01002]
    103385492
Enzymes [BR:csem01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.23  acylglycerol lipase
     103385492
Peptidases [BR:csem01002]
 Serine Peptidases
  Family S33
   103385492
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Abhydrolase_1 Abhydrolase_6 Hydrolase_4 Ndr Thioesterase DUF1057
Motif
Other DBs
NCBI-GeneID: 103385492
NCBI-ProteinID: XP_008317629
Position
10
AA seq 341 aa AA seqDB search
MMAADVDMLNLVVIAAATLAVPILVFMASFLLWPSALIKVYYWYWRRTLGLKVRSADCAG
YRFSFSYRGKPDFRPSILMLHSFSGHKDTWLSLIKYLPKHLHLVCVDMPGHEGTTRTNTE
DYSIPGQVKRIHQFVETVRLNRKPFHLVGTSMGGNVAGVYAACYPSDICSITLICPDGVR
HPCETKFDNHLQDLEQSNFTLNIPLIPTTPEEMEDMFRLCSHVRFRIPQQILQGLLDVRQ
PHNTFYQDVFMEIIGEKSRFALQDHLHLITAPLQVIWGKQDQVVDVSGAAVIAEVVPGCR
LDLLENCGHSVVMERPCRTAKLILEFVIDQQEKRGSAKKSS
NT seq 1026 nt NT seq  +upstreamnt  +downstreamnt
atgatggctgctgacgtggacatgctgaacctggtcgtcatcgccgcggcaacactggcc
gtccctattctggtgttcatggcgtccttcctgctgtggccctcagctctcatcaaagtc
tattactggtactggaggaggactctgggtctgaaggtccggtctgcagactgtgctggt
tatcgtttcagcttctcctacagagggaaacctgacttcagaccctccatcctgatgctg
cacagtttctctggccacaaggacacgtggctcagtctgatcaagtatctgccaaaacat
ctgcacctcgtgtgtgtggacatgcctggccacgagggaaccacacgcaccaacacagag
gactactctattccaggacaggtcaagagaatccaccagtttgtggaaaccgttcgattg
aacaggaaacccttccacctggtgggaacctccatggggggcaacgtggccggggtgtac
gcagcctgctacccatcagacatctgtagcatcactctgatctgccccgatggtgtcaga
catccctgtgagaccaagtttgacaaccacctgcaggacctggagcagagcaacttcacc
ctgaacatccctctgatccccaccacacctgaggagatggaggacatgttcagactgtgt
tcccacgtccgcttcaggatccctcagcagattctccagggtctgctggatgttcgtcag
ccacacaacactttttatcaggacgtgttcatggagattattggtgagaaatccaggttt
gctctacaggatcatttacatctgatcacagcgcccctacaggtgatatggggaaaacaa
gaccaggtggtggatgtgtctggagctgcggtcattgcggaggtggtgcctggttgtaga
ctggacctcctggagaactgtggtcactccgtggtcatggagcggccctgtcgcacggcc
aagctgatcctggagtttgtcatcgaccagcaggagaagaggggcagcgccaagaagtcg
tcctga

DBGET integrated database retrieval system