KEGG   Cynoglossus semilaevis (tongue sole): 103386707
Entry
103386707         CDS       T04866                                 

Gene name
asic1
Definition
(RefSeq) acid-sensing ion channel 1 isoform X2
  KO
K04829  acid-sensing ion channel 1
Organism
csem  Cynoglossus semilaevis (tongue sole)
Brite
KEGG Orthology (KO) [BR:csem00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:csem04040]
    103386707 (asic1)
Ion channels [BR:csem04040]
 Ligand-gated channels
  Acid-sensing ion channel (ASIC)
   103386707 (asic1)
SSDB
Motif
Pfam: ASC
Other DBs
NCBI-GeneID: 103386707
NCBI-ProteinID: XP_008319328
UniProt: A0A3P8WQ91
Position
11
AA seq 560 aa
MPVRIMCTISFSADDEQGRGYGSEGFDDHYKRVNKSYSDGGSQEFLDRRSQADDYNEEEE
EVSDLDDLATFFDGCSLHGANHIFVENKKFGIRQGLWAVVFTIALSAFLMQVADRVIYFL
QYDHITMLDEKVADNMTFPAVTICNYNFIRKSQMSYSDLIFMGPLLGFEEGSAPGFQLAP
EPNRPLGARFTLDEFYTRTKHQLEDMLLECNFRGIECGPENFKEIFTRYGKCYTFNSGQD
GRPLLVTMKGGMGNGLELMLDIQQDEYLPVWGETDETSFEAGIKVQIHTQDEPPFIDQLG
FGVAPGFQTFVSCQEQRLTYLPPPWGDCRDRPMDSDFFSSYSITACRIDCETRYLVENCN
CRMVHMPGDAPYCTPEQYKECADPALDFLVERDNDYCVCETPCNLTRYGKELSFVKIPSK
ASAKYLAKKFNKTEQYIADNLLVLDIFFEALNYETIEQKKAYELAGLLGDIGGQMGLFIG
ASILTILELFDYLYEVIKYKLCRCVKKKHKGHNNNDRGAVLSLDDVKRHAPCENLRTPST
YPGNMLPHHPGQGNFEDFTC
NT seq 1683 nt   +upstreamnt  +downstreamnt
atgccggtccgtatcatgtgcaccatctccttctctgccgacgatgaacagggcagagga
tacggcagcgagggttttgacgaccattacaagcgcgtgaacaagagctacagcgacggc
ggctctcaggagttcctggatcgccgaagtcaggcggacgattacaacgaggaggaggaa
gaagtcagcgacttggacgacctggccactttcttcgatggctgctccctgcacggtgcc
aaccacatctttgtggagaacaagaagttcggaatccgtcagggtctttgggcggtggtc
ttcaccatagccctgtctgctttcctgatgcaggtggctgacagggtcatctactttctc
cagtacgaccacatcaccatgttggacgagaaagtggccgataacatgactttcccagca
gtcaccatttgtaactacaactttattcgtaagtctcagatgagctactccgacctgatt
ttcatggggcctcttctgggcttcgaggaaggcagcgcaccagggtttcagctcgcccct
gagccgaaccgtccactgggggctcgcttcaccctggatgagttctacacccgcaccaag
caccaattagaagacatgctgctggagtgcaactttcgcggtatcgagtgcggcccagag
aatttcaaggagattttcacacgatatggaaaatgctacaccttcaactcgggccaggat
gggcgacccctgctggtgacgatgaaggggggaatgggcaacggcctggagctgatgttg
gatatacagcaggatgagtacttgcctgtgtggggagagaccgatgagacatcatttgaa
gctgggatcaaagtgcagatccacactcaggatgagccgccgttcatcgaccagctgggc
ttcggagtagccccaggatttcaaacattcgtttcctgtcaagagcagcggctgacatat
ctgcctccgccctggggtgactgcagggacaggcccatggactcagatttcttcagcagc
tacagcatcacagcctgtcgaatcgactgtgagacacgatacctggtggagaactgtaac
tgcaggatggtccacatgcctggagacgccccatactgcactccggagcagtacaaagag
tgtgcagatcccgctttagactttcttgtcgaacgggataatgactactgtgtgtgcgag
acgccgtgcaacttgacacgctacggcaaagagttgtcctttgtcaaaatacccagcaaa
gcgtccgccaagtacctcgccaagaaattcaacaagacggagcagtacatcgccgataac
ctcctggtcctggatatcttctttgaagcactcaactatgaaaccatcgaacagaaaaag
gcctatgagttggcaggacttctgggtgatatcggcggacagatgggtctgttcatcgga
gccagcattctcaccattcttgaactttttgactatctttatgaggtgataaagtataag
ctgtgccgctgcgtgaaaaagaaacacaaaggccacaacaacaacgaccggggagctgtg
ctgagcctggacgacgtgaaacgccatgctccgtgtgagaatctgcgtacgccgtcgaca
tatcctggcaacatgctacctcatcacccaggccagggtaactttgaggacttcacttgc
tga

DBGET integrated database retrieval system