KEGG   Cynoglossus semilaevis (tongue sole): 103386710
Entry
103386710         CDS       T04866                                 

Gene name
rdh5
Definition
(RefSeq) 11-cis retinol dehydrogenase
  KO
K00061  11-cis-retinol dehydrogenase [EC:1.1.1.315]
Organism
csem  Cynoglossus semilaevis (tongue sole)
Pathway
csem00830  Retinol metabolism
Brite
KEGG Orthology (KO) [BR:csem00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    103386710 (rdh5)
Enzymes [BR:csem01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.315  11-cis-retinol dehydrogenase
     103386710 (rdh5)
SSDB
Motif
Pfam: adh_short adh_short_C2 KR DUF1776
Other DBs
NCBI-GeneID: 103386710
NCBI-ProteinID: XP_008319331
Position
11
AA seq 341 aa
MESPSVQDILGENAWLYIGATVVVLWFIVWLYRDSLEIEELTDKYVFVTGCDSGFGNLLC
KKLDRKGFRVLAGCLTEKGADDLKRSAGPYLKTMSAGAYLKTVLLNVTNQDSVQKAMEFT
KNEVGEKGLWGIVNNAGCSLPMGPSEWMRVEDFQNTLKVNLNGMISMTMTFLPLIKKARG
RIVNVASVLGRVAANGGGYCISKFAVEAFSDCLRRDINYFGVKVCIIEPGFFRTAVTSLD
PLERELHRLWNQLSPDVQASYGDKYLDKYIKVQRLIMNAVCDSDLTKVTSCMEHALTAVH
PRSRYSAGWDAKLLWIPLSYMPSCVVDIGLKLVLPRPSKSV
NT seq 1026 nt   +upstreamnt  +downstreamnt
atggagtcaccgtcagtccaggacattttaggggagaatgcttggctgtacatcggtgct
actgtggtggtgctgtggttcatcgtgtggctgtacagagacagcctggagattgaagaa
ctcaccgacaagtatgtgtttgtgacgggctgtgactcagggttcgggaacctgctgtgt
aagaagctggatcggaaaggtttccgtgtgctggctggctgtctgacggaaaaaggagcc
gatgacctgaagaggtcggccggcccttatctgaaaaccatgtcggccggtgcttatctg
aaaaccgtcctgcttaacgttaccaatcaggatagtgtccagaaagccatggagttcacc
aaaaatgaagttggagagaaaggactctggggcattgtaaacaacgctggatgttcatta
ccaatgggcccttcagagtggatgagagtagaagatttccaaaacacacttaaagttaat
ttgaacggaatgatttccatgacaatgactttcctgcccctcatcaagaaggctcgcggc
cgcatcgtcaacgtagcatcagtgctgggccgagtggccgcgaatggtggaggatactgc
atctccaagtttgccgtcgaagccttttctgactgcctcaggagggacattaactacttc
ggagttaaagtttgcatcatcgagccgggcttcttcagaaccgccgtgacgagcctcgac
ccactggagagggaactgcatcgcttgtggaaccagctcagccctgacgtccaggccagc
tatggagacaagtacctggataaatacatcaaagtccagcgtttgatcatgaatgcagtg
tgtgactctgacctgacaaaggtgaccagttgcatggagcatgctctgactgctgtgcac
ccacgcagcagatacagcgctggctgggatgctaaacttctctggatcccgctctcttac
atgccttcctgtgtggtggacatcggactgaagctggtgctgcctcgtccatcgaagagt
gtgtga

DBGET integrated database retrieval system