KEGG   Cynoglossus semilaevis (tongue sole): 103387481Help
Entry
103387481         CDS       T04866                                 

Gene name
ide
Definition
(RefSeq) insulin-degrading enzyme isoform X1
  KO
K01408  insulysin [EC:3.4.24.56]
Organism
csem  Cynoglossus semilaevis (tongue sole)
Brite
KEGG Orthology (KO) [BR:csem00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:csem01002]
    103387481 (ide)
Enzymes [BR:csem01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.24  Metalloendopeptidases
    3.4.24.56  insulysin
     103387481 (ide)
Peptidases and inhibitors [BR:csem01002]
 Metallo peptidases
  Family M16: pitrilysin family
   103387481 (ide)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Peptidase_M16_M Peptidase_M16 Peptidase_M16_C TaqI_C
Motif
Other DBs
NCBI-GeneID: 103387481
NCBI-ProteinID: XP_008320371
Position
12
AA seq 1025 aa AA seqDB search
MFKCINRAAQSKRYLRSGSTTFCFVKHRRFRELKLIFLLLLSSLPLRMNDTAVNRVVTEI
IRSPEDKRVYRGLEFANGLKAMLISDPTTDKSSAALDVHIGSLSDPVNISGLAHFCEHML
FLGTKKYPKENEYSQFLSEHAGSSNAFTSGEHTNFYFDVSHEHLEGALDRFAQFFLCPLF
DESCKDREVNAVDSEHEKNLMNDAWRLFQLEKATGNPNHPFSKFGTGNKLTLETRPSQDG
LDVRQQLLQFHSTYYSSNLMGLCVLGRESLDDLTSMVVKLFGEVENKNVPLPEFPEHPFQ
EEHLRQFYKVVPIKDIRNLHVTFPIPDLQKYYKSNPGHYLGHLIGHEGPGSLLSELKAKG
WVNTLVGGQKEGARGFMFFIINVDLTEEGLLHVDDIIFHMFQYIQKLRTEGPQEWVFEEC
KDLNRVAFRFKDKERPRGYTSKVAGLLHYYPLEEVLAAEYLLEDFRPDLIEMVLDKLRPE
YVRVAVVSKSYEGHTDKTEEWYGTQYKQEAISEETIKKWQNADLNGKFKLPMKNEFIPTN
FEIYPLEKDSPSVPTLIKDTAMSKVWFKHDDKFFLPKACLNFEFFSPFAYVDPLHCNMAY
LYLELLKDSLNEYAYAAELAGLNYDLQSTVYGMYLSVKGYNDKQHILLRKIIEKMASFEI
DEKRFDIIKEAYMRSLNNFRAEQPHQHAMYYLRLLMTEVAWTKDELREALDDVTLPRLKA
FIPQLLSRLHIEALLHGNITKESALGMMQMVEDTLIEHAHTKPLLPSQLIRYREIQIPDG
GWYVYQQRNDVHNNCGIEIYYQTDMQATHDNMLLELFCQIISEPCFNTLRTKEQLGYIVF
SGPRRANGVQGLRFIIQSEKAPHYLESRVEAFLCTMEKAVEEMSEEAFQKHIQALAIRRL
DKPKKLSAECAKYWGEIISQQYNFDRDNVEVAYLKTLTKENVIQFYRERLMVDAPKRHKV
SVHVLSREMDTCPAVGEFPAQNDVNLAPAPSLPQPTLVQDMTEFKRSLPLFPLVKPHINF
MAAKL
NT seq 3078 nt NT seq  +upstreamnt  +downstreamnt
atgtttaagtgtattaaccgggcagctcagagtaagaggtatcttcgttcaggaagcacc
actttctgttttgtaaaacatcgtagattccgagagttgaagctcatcttcctcctgctg
ttgtcatccttgccactcagaatgaacgacacagccgtaaatagggtggttactgaaata
atacgttctccggaagacaaacgggtttacagaggcctggagtttgccaatggcttgaag
gccatgctcattagtgacccaacaacagacaaatcctctgctgctttagatgtacacatt
ggttctttatcggacccagtgaatatatcgggcctggcacatttctgtgagcacatgctg
ttcctgggaacaaagaagtatcccaaagagaatgaatatagccagtttctcagcgagcat
gcagggagctccaatgcctttactagtggagagcataccaacttctactttgatgtttcc
catgagcacttggaaggagcattagacaggtttgctcagtttttcctttgccccttgttt
gatgagagttgtaaggatcgggaggtgaatgctgtggactcggagcacgagaaaaacctc
atgaatgatgcctggagactctttcagttggaaaaggcaactggcaaccctaaccacccc
ttcagtaaatttggaacaggcaataagttgacccttgagaccagaccatcccaggatgga
cttgatgtccgccagcagctcctgcaatttcactccacatattactcctctaacctcatg
ggactgtgcgtgttaggcagagaatcattagatgacttgacctccatggtggttaagctc
ttcggagaagtggagaataagaatgtgcctctcccagaattcccagaacatcccttccag
gaagaacatctcagacaattctacaaggtggtgccgatcaaagacatcaggaaccttcat
gtgacttttcccatcccagacctacaaaagtactacaagtctaatcctggacattacctg
ggtcatttaattggccatgaaggacctggaagtttgttgtctgagctgaaagctaaaggc
tgggtgaacacgctcgtaggaggacaaaaagaaggagccagaggatttatgttcttcatc
atcaacgttgacttaacagaggaaggcctcttgcatgtggacgacatcatcttccacatg
ttccagtacatccagaaactacgtactgaagggccccaggaatgggtgttcgaggagtgc
aaggatttgaacagagtggccttcagattcaaggacaaagagcgacctcgtggctacacc
tccaaagtggctggtttactacactactaccctcttgaagaggtccttgcagcagagtat
cttctagaagatttcagaccagatctaattgagatggtgttggacaagctgaggccagag
tatgtcagagttgcagtggtctcaaagtcgtatgaagggcacacggataaaactgaagaa
tggtacggtacacagtacaaacaggaggccatctctgaagagaccattaagaaatggcaa
aatgcagatctcaatggaaaatttaaattacctatgaaaaacgagttcatcccaaccaac
tttgaaatttaccctctggagaaagattctccttcagtcccaactttaatcaaggatact
gcaatgagcaaggtgtggtttaaacatgatgacaagtttttcctcccaaaggcttgcctg
aactttgagttcttcagcccgtttgcatatgtggacccattgcattgtaacatggcatat
ttatacctggagctcctcaaggactccctcaacgagtatgcatatgcagccgagctagct
ggtttgaactatgacctccaaagtaccgtctatgggatgtatctgtctgtcaaaggctac
aatgacaaacagcatatcctgctgaggaagatcattgagaaaatggcctcatttgagatc
gacgagaagcgttttgacatcatcaaggaagcatacatgaggtctctgaataacttcagg
gcagaacagcctcatcagcatgccatgtactacctccgcctactaatgactgaggttgct
tggaccaaagatgagctccgcgaggctctggatgatgtaactctcccacgcctcaaggcc
ttcatacctcagctattgtcacggttacatattgaagcacttctccatggcaacatcacc
aaggagtctgctcttggtatgatgcaaatggtggaggatacactcatcgaacacgctcac
accaagcccctccttccaagccagctcattcgctacagagagattcagattccagatggt
ggctggtatgtatatcaacaaagaaatgacgtgcacaacaactgtggtatcgagatctac
tatcagacggacatgcaggccactcatgacaacatgctgcttgagctgttctgtcagatc
atctctgagccctgcttcaacacactaagaaccaaagaacagctgggctacatagtgttc
agtggacctcgacgggccaatggagttcagggactgcgctttattatccagtcagagaag
gccccccactacctggagagccgcgtggaagctttcctttgtaccatggagaaggctgtg
gaggagatgagtgaggaagctttccagaaacacatccaggccctcgccatccgccgcctg
gacaaacctaagaagctgtcggcagagtgcgccaagtactggggagagatcatctctcag
cagtataactttgacagagataacgttgaagttgcttatctgaagactttgacaaaagaa
aacgtaattcagttctacagagaacgtctgatggtggatgcacctaaaagacacaaagtg
tctgtacacgtcttgtccagagaaatggacacctgtccagcagtgggagaatttcctgct
cagaacgatgtcaaccttgcccccgctccctccctgccacagcccacattggttcaggac
atgacagaatttaagaggagtcttcctttgttcccattggtcaaacctcacatcaacttc
atggctgctaaactgtga

DBGET integrated database retrieval system