KEGG   Cynoglossus semilaevis (tongue sole): 103387684Help
Entry
103387684         CDS       T04866                                 

Definition
(RefSeq) multiple inositol polyphosphate phosphatase 1-like
  KO
K03103  multiple inositol-polyphosphate phosphatase / 2,3-bisphosphoglycerate 3-phosphatase [EC:3.1.3.62 3.1.3.80]
Organism
csem  Cynoglossus semilaevis (tongue sole)
Pathway
csem00010  Glycolysis / Gluconeogenesis
csem00562  Inositol phosphate metabolism
csem01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:csem00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    103387684
   00562 Inositol phosphate metabolism
    103387684
Enzymes [BR:csem01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.62  multiple inositol-polyphosphate phosphatase
     103387684
    3.1.3.80  2,3-bisphosphoglycerate 3-phosphatase
     103387684
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: His_Phos_2
Motif
Other DBs
NCBI-GeneID: 103387684
NCBI-ProteinID: XP_008320664
UniProt: A0A3P8WGB9
Position
12
AA seq 479 aa AA seqDB search
MTSSVRVLGRNLPELCVIMTPNFWILVVALLINITGFYCCLYSEEDPDIPVIAKYFTTKG
RYEEVNPHLRDDILFVNRSALKPPSPQCREAHLTAVIRHGTRYPTIKNIQKMRRLYGLVE
SRASGEESWLREIQSQWTMWYTDDMDGRLAMKGVSDHKHLAVRLSKLFPSLLTEEKLRAG
QVNFMTSSKHRCVNSTLSFMAGLTEQWAIRDVEFEHTLNDALMRFFDKCTRFVEEIDKNA
TALAEMQLFKEGPEMRRVQEKIADRLRVPYQSITEEMAEAAFDLCAYEFAIKAVNSPWCC
LFDEVDALVMEYSNDLKQFWKRSYGHDINSKASCILFHDVFSRLDKAANEIKSGQQVTEA
VTIQIGHAETLLPLLTLLGFFRDSEALKSTNFAQQAQRSFRTSYMMPYAANLLLVLYDCG
NGDLRLQALLNEKPVAFPGLTDLTSSMPRYEDVRSHYRELLRGCDFETECQLFNKPVDS
NT seq 1440 nt NT seq  +upstreamnt  +downstreamnt
atgacgtcatcagttagggtcctcgggcggaatttgcctgaactgtgtgttatcatgacg
cccaacttttggatcctcgtcgtcgcgcttctcatcaacataaccgggttttactgctgt
ctttattcggaagaagacccagacataccagtcattgccaaatatttcaccaccaagggg
agatatgaggaagtgaacccacatctccgagacgacatactcttcgtcaataggtccgcc
ctgaagcctccatctccacaatgccgagaggctcatctgacagccgtcatcaggcacggc
accagataccctacgattaaaaacatccagaagatgagacggctgtacgggctggttgag
agccgagcctctggagaagagagctggctgcgggaaatccagagccagtggacgatgtgg
tacacggatgacatggacggccgactggccatgaaaggagtgagtgaccacaagcacctg
gccgtcaggctgtccaagctcttcccctcactgctgactgaggagaagctgcgggctgga
caggtgaacttcatgacgagctccaagcacagatgtgtcaacagcacgttgtccttcatg
gcgggactgacagaacagtgggcgatcagagatgtggagtttgaacacacactgaatgat
gctctgatgagattctttgacaagtgcaccaggtttgtagaggaaattgacaaaaacgcc
acagccttagcagagatgcaactgttcaaggagggaccagagatgaggagggtccaggaa
aaaatcgcagaccgccttcgtgtcccataccagtccatcacagaggaaatggcagaggct
gcctttgatttgtgcgcgtatgagtttgccatcaaggccgtgaactcgccttggtgttgc
ctctttgatgaagttgatgctctggttatggagtattcaaatgacctgaagcagttctgg
aagagaagctacggccatgacatcaacagcaaggcaagttgcatattgttccacgatgtg
ttcagccgactggacaaggcagcaaacgagatcaaatctggccagcaagtgactgaagct
gtgacaatccagataggccacgcagagactctactgccactgcttaccctgctgggcttc
tttagggacagtgaagccctgaaatcaacaaactttgcccaacaggcccagcgttctttc
cgtaccagctacatgatgccctacgctgctaacctgcttttggtgttgtacgactgcgga
aatggtgacctgagactgcaggcactcctcaacgagaagcctgtggcgtttcctggtttg
actgacctgacatcctccatgccacgttatgaagatgtcagaagtcactacagagaactt
ctccggggctgtgactttgagactgagtgtcagctgttcaacaaaccagtggacagttag

DBGET integrated database retrieval system