KEGG   Cynoglossus semilaevis (tongue sole): 103388543
Entry
103388543         CDS       T04866                                 

Gene name
ankrd53
Definition
(RefSeq) ankyrin repeat domain-containing protein 53
  KO
K21441  ankyrin repeat domain-containing protein 53
Organism
csem  Cynoglossus semilaevis (tongue sole)
Brite
KEGG Orthology (KO) [BR:csem00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:csem03036]
    103388543 (ankrd53)
Chromosome and associated proteins [BR:csem03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Spindle formation proteins
    103388543 (ankrd53)
SSDB
Motif
Pfam: Ank_2 Ank_5 Ank_4 Ank Ank_3
Other DBs
NCBI-GeneID: 103388543
NCBI-ProteinID: XP_016886844
Position
1
AA seq 388 aa
MCEENNKELPTQEEKEEEQEAEKEEDALEKLDRNIKINTTLSSKIKQGLSSLHMLCLYGQ
LAELQRLLSSSSAGAAQINSRDSQGHRPLHMLMSSQSSPRTSACLRVLLENGAEANVTSD
VGQTPLHMAASEGLLNCVEILVQAGADVTLQDTMGHTPLDMARIWCHRKVARYLKSCMWE
EAKKKEMKEIRRANVLYTDLVAMVKFSDVSPKTQEEKMSETSKQKSHPKHTKVPVSQYHV
QCLSLNEDRPHQERKSLKKEQNNLQKIDVSKIPPDLQFKNITTSLQRRSTSEPDLRDSVT
LWKDRHSGRPQYTTKWNCVPQTAPDLPLNVLKKVLFPKAFPSRILGSQDFQPQNISEVQH
KGRSRGRSTSTWTEVAMHLVHMLEPGHY
NT seq 1167 nt   +upstreamnt  +downstreamnt
atgtgtgaggagaacaataaggagctgcccacccaggaggagaaagaggaggagcaggag
gcagaaaaggaggaggatgctctggaaaaattggacagaaatataaagattaatacaaca
ttgtcctcaaaaataaaacagggtctgtcctcactgcacatgctctgtctgtatggccag
ctggctgagcttcagcgtcttctgtcgtcctcgtctgcaggagcagctcagatcaacagc
agagattctcagggtcaccgacctctccacatgctcatgtcctcccagagctcccctaga
acatcagcctgtcttagggttctgctggagaatggagctgaagctaatgtaacctcagat
gtgggtcaaacaccactccacatggcagcttctgaaggtctcctgaactgtgtagagatc
ctagtccaggccggcgctgatgttacgctccaagatactatgggacacactccactggat
atggcccgcatctggtgtcacagaaaggtagcaagatacctaaagagctgcatgtgggag
gaagcaaagaagaaagagatgaaggagatcaggcgagccaacgtgttatacactgatctg
gtggccatggtcaaattcagtgatgtcagcccaaagacacaagaagaaaagatgtcagag
acaagtaagcagaagagtcacccaaagcacactaaagtcccggtgagtcagtaccatgtc
cagtgtctatcattaaatgaggacagacctcaccaggaaagaaagagtttgaagaaggaa
caaaacaatcttcagaagatcgatgtctcaaagataccgcctgacttacagtttaagaac
attaccaccagccttcagcgcaggtcaacctcagagccagacctcagggacagtgtgacc
ctgtggaaggacaggcacagcgggcgtcctcagtacacaaccaagtggaactgtgtccct
caaactgctcctgatctacctttgaatgtcctgaagaaggtattgttccccaaagcgttc
ccatccaggatcctcggctcccaggatttccagccacagaacatctcagaggtccagcac
aaaggacgctctagggggcgcagcacctccacctggactgaggtagccatgcacctggta
cacatgctggagcctggacactactga

DBGET integrated database retrieval system