KEGG   Cynoglossus semilaevis (tongue sole): 103388706Help
Entry
103388706         CDS       T04866                                 

Definition
(RefSeq) soluble guanylate cyclase 88E-like
  KO
K01769  guanylate cyclase, other [EC:4.6.1.2]
Organism
csem  Cynoglossus semilaevis (tongue sole)
Pathway
csem00230  Purine metabolism
csem01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:csem00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    103388706
Enzymes [BR:csem01000]
 4. Lyases
  4.6  Phosphorus-oxygen lyases
   4.6.1  Phosphorus-oxygen lyases (only sub-subclass identified to date)
    4.6.1.2  guanylate cyclase
     103388706
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: HNOBA Guanylate_cyc HNOB LMBR1
Motif
Other DBs
NCBI-GeneID: 103388706
NCBI-ProteinID: XP_008322045
UniProt: A0A3P8VHM0
Position
13
AA seq 815 aa AA seqDB search
MYGLYLEAVNDYINESYGEDVWRLIENRAEIPHLKFVRHQMYNDNLILRLAKAAGEVLGK
THDELMYAFGVYMVKRIGNYGYERILKVLGRNVRDFINELDNLHEYFRFSFPKVQPPSFC
VEEECETSLTLHYRSTRKGFTQFVKGQLSQVGRQFYNTDIEVEILSKEETEKMTYVVYKM
NFDNAAFKHRMPQQKTAPSYEKLPMKRGIFFDMFPFSVIFRRDMTMYRIGDGLKEVFSDL
QGKKVNEEFTLVRPMLEFSWDNIYTHLNNVFELLSKAVVESKQKVNIPKLNKEEPDEKEE
SEKAKREEEREQKAVEEIKGTDQEYSSALTQYNSSANSGGEDIELLAFQTVTGKCSETIF
EDMREPPKKPLHLKGQMKYVPQWDSLIFLGTPIIETVEDMIKMGVYVNDLNLHDSSRELI
LAGTQQSAELQLALDQEQQKYAQLQEIIKKLDEEKKRGDSLLYAMIPKAVADRLRKGITA
LETCQVFPDVTILFSDVVKFNEICIHITPMQVVDMLNEIYIVFDTLSEKHNVYKVETIRD
AYMVVAGVPNKTTFHAHHICDMALDMLSSIDHLKDPSTGDNIQIRVGIHSGMVVAGVVGL
KMPRYCLFGDTVNTASRMESNGVGMQIHISQTTKDHLEHEPYIIEERGKIFVKGKGYMKT
YWLKGKKDLSFKTPAELRYSSEQKDSEDKSSNDSTSTNAKRMASNLHITGNDEQAEGKPS
PSDMPLDTLPPPEAANEPAANSTEPQEKEKAKKTKNNKGAKLEVPQGNALPESSSPADGM
ENPGPLLNNKRNSFRQQYAKLPTNLPIRSSSCSIL
NT seq 2448 nt NT seq  +upstreamnt  +downstreamnt
atgtacggcctgtacttggaagcagtcaacgattacatcaacgaatcctacggagaggat
gtgtggaggctgatcgagaaccgagcagagattccacacctcaagtttgtcagacatcag
atgtacaatgataacctgatccttcgactggcaaaagctgccggcgaggtcctgggaaag
acccacgatgagctgatgtacgccttcggggtctacatggtgaagaggattggaaactat
ggatacgaacgtatcctgaaggtgctgggacgaaatgtacgcgacttcatcaatgaactg
gataacctccacgagtactttcgcttctccttccccaaagtccagcctccgagtttctgc
gtggaggaggagtgtgagaccagcctgactctgcactaccgcagcacccgcaagggcttc
acacagtttgtcaaaggacagctctctcaggtgggccggcagttctacaacacagacatt
gaagtggaaatcctgtctaaggaggagacagagaagatgacatacgtggtttataagatg
aactttgacaacgcagccttcaagcaccgcatgccccaacagaagactgcgccaagctac
gagaagctgcccatgaagcggggcatctttttcgacatgttccccttcagtgttatcttc
cgccgcgacatgaccatgtaccgcattggagatggcctcaaagaggtcttctctgacctc
cagggcaagaaggtcaatgaggagttcactctggtcaggcccatgctagagttcagctgg
gataacatttacacccatttaaacaacgtgtttgagctcttgtctaaagccgtggtggag
agcaagcagaaggtcaacatcccaaaactgaacaaagaggagccagatgagaaggaggag
agcgagaaggcaaaaagggaagaagaaagagaacaaaaggcagtggaggagataaagggc
acggaccaggagtacagcagtgctctcacccagtacaacagctctgccaactcaggggga
gaagacattgagctgctggccttccagactgtgactggaaagtgtagcgagaccatattt
gaggacatgcgggagcctcccaagaaacctctccatctgaagggtcagatgaagtatgtc
ccccagtgggactccctcatcttcctgggcacacccatcatcgagacagtggaggacatg
attaaaatgggtgtatacgtgaacgatctgaatctgcacgactccagcagagagctgatt
ttggccgggacacagcagtcggctgagctgcagctggctctcgatcaggagcaacaaaaa
tatgctcagctgcaggaaatcatcaaaaagctggacgaggagaagaagagaggagactct
ctgctgtacgccatgatccctaaagctgtggccgaccgcctcaggaaggggatcacggca
ctggagacctgccaggtcttcccagacgtgaccatcctgttcagcgatgtggtcaagttt
aatgagatctgcatccacatcacacccatgcaggtggtggacatgctgaatgagatctac
atcgtctttgacacgcttagcgagaagcacaacgtctacaaggtggagacgatccgagat
gcctacatggtggtggcaggcgttcccaataagaccaccttccatgcacaccacatctgc
gacatggctctggacatgctgagctccatcgaccatctcaaagacccgtctacaggagac
aacatccagatcagagtcggtatccactcaggaatggtggtggccggtgtggtgggtctg
aagatgcctcgctactgtctgtttggtgatacagtgaacacagcctcacggatggagagc
aatggagtgggcatgcagattcacatcagccagaccaccaaagaccacctggaacatgag
ccctacatcatcgaggagaggggaaaaatctttgtcaagggcaaaggctacatgaagacc
tactggctaaaaggaaagaaagacctgtcgttcaagaccccagcagagctgcgctacagc
agtgagcagaaggattcagaggacaagagctctaatgattccacaagcaccaacgccaaa
cgcatggcctcaaacctccacatcaccggcaatgatgagcaagctgagggaaaaccaagc
cccagtgacatgcccctggacaccctgcccccaccagaggccgccaatgagcctgctgca
aattcaactgagcctcaggaaaaggagaaagccaaaaagactaagaacaacaagggagcg
aagctggaagtgccacagggaaatgctcttccagagtcctcgtcaccagctgacggcatg
gagaacccaggtcctctactcaacaacaagagaaacagcttcaggcagcagtatgccaag
ctgcccaccaacttgcctatccgcagctcctcctgctctatcctgtga

DBGET integrated database retrieval system