KEGG   Cynoglossus semilaevis (tongue sole): 103388766Help
Entry
103388766         CDS       T04866                                 

Gene name
ddc
Definition
(RefSeq) aromatic-L-amino-acid decarboxylase
  KO
K01593  aromatic-L-amino-acid/L-tryptophan decarboxylase [EC:4.1.1.28 4.1.1.105]
Organism
csem  Cynoglossus semilaevis (tongue sole)
Pathway
csem00350  Tyrosine metabolism
csem00360  Phenylalanine metabolism
csem00380  Tryptophan metabolism
csem01100  Metabolic pathways
Module
csem_M00037  Melatonin biosynthesis, tryptophan => serotonin => melatonin
csem_M00042  Catecholamine biosynthesis, tyrosine => dopamine => noradrenaline => adrenaline
Brite
KEGG Orthology (KO) [BR:csem00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00350 Tyrosine metabolism
    103388766 (ddc)
   00360 Phenylalanine metabolism
    103388766 (ddc)
   00380 Tryptophan metabolism
    103388766 (ddc)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:csem04147]
    103388766 (ddc)
Enzymes [BR:csem01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.28  aromatic-L-amino-acid decarboxylase
     103388766 (ddc)
    4.1.1.105  L-tryptophan decarboxylase
     103388766 (ddc)
Exosome [BR:csem04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   103388766 (ddc)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pyridoxal_deC Beta_elim_lyase DUF5601
Motif
Other DBs
NCBI-GeneID: 103388766
NCBI-ProteinID: XP_008322125
UniProt: A0A3P8VSD1
Position
13
AA seq 480 aa AA seqDB search
MDIAEFRRRGREMVDFVADYYENIEKRPVFPDVEPGYLRSLIPSEAPVDPETYEDIMKDV
ERVIMPGVTHWQSPNFFAYFPANSSLPALLADMLSGAIGCIGFTWAASPACTELETVMLD
WLGKMLQLPECFLAGTDGQGGGVIQGTASEATLMSLLAARCKTVRRVQASNSQLLEGEIF
SKMMAYTSEEAHSSVERAAQIAGVMIRKVPTDDTYAVRGEMLKKMVEMDKAAGLIPFYFC
ATLGTTPSCAFDHITELGPICNDENMWMHVDAAYAGSAFVCPEFRHLLNGIEYANSFDFN
PHKWLLVNFDCSAMWVKNRADLIGAFKVDPLYLKHENQESGLVTDYRHWQIPLGRRFRSL
KMWFVFRLYGHKGLQSHIRHHVTLAKEFESLVRADKRFEICAEVILGLVCFRLKGEDVLS
ENLLKKINQKREIHLVPCQLSGRFVLRFAVCSRTTESHHIQKAWQHITQLTFEVLQVSNY
NT seq 1443 nt NT seq  +upstreamnt  +downstreamnt
atggatattgccgagttccgtcgcagaggaagggagatggtcgactttgtggctgactac
tatgagaacatagaaaagagacccgtcttcccagacgttgaaccaggatatcttcgctct
ctaatccccagcgaggctccagtggatccagaaacctatgaggatattatgaaagatgtg
gagagagtgataatgccaggggtgacacactggcagagcccaaacttttttgcttacttc
ccagctaattcctcattacctgcccttttggctgacatgcttagtggagccattggctgc
attggatttacttgggctgccagcccagcctgcacagagctggagactgtgatgttggat
tggcttggaaagatgctacaactgcctgagtgtttcttagctgggactgatggtcaagga
ggaggtgtcatccagggcactgccagtgaagccactctaatgtctctgcttgctgctcgg
tgtaaaacggttcgaagggttcaggcctccaactctcaactcttagagggggaaatcttt
tccaaaatgatggcatacacatctgaggaggctcattcctcagtggagcgtgcagctcag
attgcaggagtgatgatcaggaaggttccgacagatgacacttatgccgttagaggggaa
atgctgaagaagatggtggagatggataaggcagctggactgataccattttatttttgt
gcgactctcggcaccactccttcctgtgcttttgatcacatcactgaactggggcccata
tgtaatgacgaaaacatgtggatgcacgtcgatgcagcgtatgcaggcagtgcttttgtc
tgccctgaatttagacatttgttaaatggcattgagtatgcaaactcatttgacttcaat
ccacacaaatggcttttagtcaactttgactgctctgcaatgtgggtgaagaacagagct
gatctaattggagctttcaaggtggatccactctacctgaaacacgagaaccaggaatca
ggtttggtgaccgattataggcactggcagattccacttggaagaaggttccgctccctg
aagatgtggtttgtcttccgtctgtatggacacaaagggcttcagtcacatatacgacat
catgtgaccctagctaaagaatttgagagtctggtacgagcagacaagaggtttgagatc
tgtgctgaagtcatcctgggtctggtctgctttagacttaagggtgaagatgtgctgagt
gagaatttactaaagaagattaaccagaaaagggagatccacctggtgccttgtcagctc
tccggccgctttgtgctgcgatttgctgtatgtagtcgaacgacagagtcacatcacatt
cagaaagcatggcagcacatcacacagctgacctttgaggtgctgcaggtgtccaattat
tga

DBGET integrated database retrieval system