KEGG   Cynoglossus semilaevis (tongue sole): 103389187Help
Entry
103389187         CDS       T04866                                 

Definition
(RefSeq) threonine synthase-like 2
  KO
K06037  O-phospho-L-threonine phospho-lyase [EC:4.2.3.-]
Organism
csem  Cynoglossus semilaevis (tongue sole)
Brite
KEGG Orthology (KO) [BR:csem00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    103389187
Enzymes [BR:csem01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.-  
     103389187
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PALP
Motif
Other DBs
NCBI-GeneID: 103389187
NCBI-ProteinID: XP_008322721
Position
14
AA seq 164 aa AA seqDB search
MDCFVPQDPYNMERVFWLLSNKDGALVKKMMEEFQLTHAHTLPDNLRKQLCEVLSSGSVS
DEGILETMRRCWEENRYLLCPHSAVAVWHHYNCPHSPALNRCYVATASPVKFQGAMNRAG
LTIDLPETVRMLDKLKSRYENLERSPDWCKKWEQRLRYKIQSFS
NT seq 495 nt NT seq  +upstreamnt  +downstreamnt
atggactgttttgtgccgcaggacccatacaatatggagcgagtcttctggctgctgtcc
aacaaagatggagccttagtgaagaaaatgatggaagagtttcagctcacacacgcacac
actctgcccgacaacctccgtaagcagctgtgtgaggttttatcatctggaagcgtctca
gatgaagggatcctggagaccatgaggagatgctgggaggagaacagatacctgttgtgt
cctcactctgccgtggcggtgtggcatcactacaactgtccacacagccctgcactcaac
aggtgctacgttgcgactgcgtcaccagttaagtttcagggggcgatgaacagagcgggg
ctgactatcgacctgcctgagacggtgaggatgttggacaagttaaagagccgttatgag
aacctggagcggagcccagactggtgcaagaagtgggagcaaagactgagatacaaaatc
cagtcttttagctga

DBGET integrated database retrieval system