KEGG   Cynoglossus semilaevis (tongue sole): 103389467Help
Entry
103389467         CDS       T04866                                 

Definition
(RefSeq) guanylate cyclase soluble subunit beta-2-like
  KO
K12319  guanylate cyclase soluble subunit beta [EC:4.6.1.2]
Organism
csem  Cynoglossus semilaevis (tongue sole)
Pathway
csem00230  Purine metabolism
csem01100  Metabolic pathways
csem04270  Vascular smooth muscle contraction
csem04540  Gap junction
Brite
KEGG Orthology (KO) [BR:csem00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    103389467
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04540 Gap junction
    103389467
 09150 Organismal Systems
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    103389467
Enzymes [BR:csem01000]
 4. Lyases
  4.6  Phosphorus-oxygen lyases
   4.6.1  Phosphorus-oxygen lyases (only sub-subclass identified to date)
    4.6.1.2  guanylate cyclase
     103389467
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Guanylate_cyc HNOB HNOBA
Motif
Other DBs
NCBI-GeneID: 103389467
NCBI-ProteinID: XP_008323106
Position
14
AA seq 708 aa AA seqDB search
MYGFINSCLQSLVLEKFGEETWKKLSSLPGVQETFMTYTVYDDILTLSLVTEACSLLDVP
SEVLLKLFGEHFFVFCKNAGYDTMLQTLGGNLVEFIENLDALHSYLALSYQEMNAPSFRV
EMTDDGKMLLHYYSDRKGLHHIVPGIMEAVGRDLFHSTVTLVVLNQSEEDERTGKKEHVV
FLVKQTKQTSESTEQRGDSEHKQEEFFRIMKDKCASLTGKMRGWDLLRAIVSTANGSSLQ
CTFTPYYPEKLWMEEKAFCNAFPFHIIFDENLKVKQTGVNIQKFVPDLQKTDATLDKFFL
IVHPQVTFTIESIRKFINSQFVLKNCKDKHSTLKLRGQMLWMDSLGCMLYLCSPKLRNLQ
ELQDVGLHLADLAQHDVTRDLVLLNQQRLAEMELTNQLERKKEELRVLSRHLEAEKEKTE
ALLYAMLPRHVANQLKDGQSVEAGEFEVCTILFSDVVTFTNICAACEPIHIVHMLNSMYS
RFDRLTSVHDVYKVETIGDAYMVVGGVPIPTQSHARRVGNFALGMRIAAREVTNPVTGRP
IQIRVGLHTGPVLAGVVGEKMPRYCLFGDTVNTASRMESHGVPDHIHLSASTYSELKDAG
FNIQERGQIKVKGKGQMTTYFLLENLLLSEDSIMGKDCGHACIYEEDMHDQCNRDASREP
DIRSVHSAGSAHIHRVTPFAWDISDPYETKKKNSSPENTHDSRLCLLL
NT seq 2127 nt NT seq  +upstreamnt  +downstreamnt
atgtacggcttcatcaacagctgcctacagtctctggtgctggagaagtttggtgaagaa
acgtggaaaaaactcagctctctacctggagtccaggaaacctttatgacatacacagtg
tatgacgacatcctgaccctgagtctggtcacagaggcttgttcactgctggatgttccc
tctgaggtcctgttaaagctatttggagaacatttctttgttttctgtaaaaacgctggc
tatgacaccatgctgcagacactgggaggaaatctggtggagttcatagaaaatctggac
gcactgcacagttacctggctttgtcttatcaggaaatgaatgcaccgtcattcagagtg
gagatgacggatgatgggaagatgcttctgcactattactctgacaggaagggtctgcac
cacatagtaccaggcattatggaggcagttggtagagacctgtttcacagcacagtgacc
ctggtggtgctgaaccagtcagaagaagacgaacgaactgggaagaaggagcacgttgtg
tttttggtcaaacagaccaaacaaacgtctgagagcacagagcagagaggagactctgaa
cacaaacaggaggagtttttcagaataatgaaggacaaatgtgcatctctgactgggaaa
atgaggggctgggatctgctcagagcaattgtttccacagcaaatggctccagtctccag
tgcacattcactccatattacccagagaagctgtggatggaggagaaggctttctgtaac
gcctttcccttccacatcatctttgatgaaaatctgaaggtgaaacagacaggagtgaac
attcagaagtttgttccagatctgcagaagacagatgctacgctggacaaattcttcttg
attgtccatccgcaggtaacttttaccatcgagagcattaggaagttcatcaacagccaa
tttgtcctaaaaaactgcaaggacaagcactccacactcaagctaagaggtcagatgtta
tggatggattctctcggctgcatgctttacctgtgttctccaaagctgagaaaccttcaa
gagcttcaggatgtgggtcttcacctggctgacctggcccagcacgatgtcaccagagac
ctggtccttctcaaccagcaacggctagctgagatggagctgaccaaccagctggagagg
aaaaaggaggagctgagagttctgtcacgccacctggaggcagaaaaagagaagactgag
gcactgctatacgccatgcttccccgccacgtggccaatcaactcaaagatggccagagt
gtggaagcaggggagtttgaggtttgcactattttattcagtgatgtggtgaccttcaca
aacatctgtgccgcctgtgagcccatccacatcgtccacatgctcaactccatgtactcc
aggtttgacaggctcaccagtgtccacgatgtctacaaggttgagaccatcggtgatgcc
tacatggtggtaggtggagttccaatacctacacaaagccacgcacgcagggtgggaaat
tttgctttgggcatgaggatcgcagcccgagaggtcaccaaccctgtgacaggaagacct
atacagatccgcgtgggcctccacactgggccagtcttagctggagtcgtgggtgagaaa
atgcctcgttactgtctgtttggcgatacagtgaatacggcttctaggatggagagtcat
ggcgtgccggatcacattcacctcagtgcttccacctacagtgaactgaaggatgcaggc
ttcaacatccaggagcgtggacaaattaaagtgaagggcaaaggccagatgaccacttac
ttccttttggagaacctgctgctatcagaggatagcattatgggaaaagactgtggtcat
gcctgtatttatgaggaggacatgcatgatcagtgcaacagagatgctagcagagagcct
gacatcagaagtgtccactcagcaggctccgcccacatccacagagtcacgccatttgcc
tgggacatcagtgatccttatgagaccaagaaaaagaacagttcacctgaaaacacacac
gacagcagactctgtctccttctctaa

DBGET integrated database retrieval system