KEGG   Cynoglossus semilaevis (tongue sole): 103389885Help
Entry
103389885         CDS       T04866                                 

Gene name
map4k4
Definition
(RefSeq) mitogen-activated protein kinase kinase kinase kinase 4 isoform X1
  KO
K04407  mitogen-activated protein kinase kinase kinase kinase 4 [EC:2.7.11.1]
Organism
csem  Cynoglossus semilaevis (tongue sole)
Pathway
csem04010  MAPK signaling pathway
Brite
KEGG Orthology (KO) [BR:csem00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    103389885 (map4k4)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:csem01001]
    103389885 (map4k4)
Enzymes [BR:csem01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     103389885 (map4k4)
Protein kinases [BR:csem01001]
 Serine/threonine kinases: STE group
  STE20 family
   103389885 (map4k4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase CNH Pkinase_Tyr Pkinase_fungal Kinase-like Serglycin
Motif
Other DBs
NCBI-GeneID: 103389885
NCBI-ProteinID: XP_008323720
Position
14
AA seq 1363 aa AA seqDB search
MANDSPAKSLVDIDLASLRDPAGIFELVEVVGNGTYGQVYKGRHVKTGQLAAIKVMDVTE
DEEEEIKLEINMLKKYSHHRNIATYYGAFIKKSPPGHDDQLWLVMEFCGAGSITDLVKNT
KGNQLKEDWIAYISREILRGLAHLHAHHVIHRDIKGQNVLLTENAEVKLVDFGVSAQLDR
TVGRRNTFIGTPYWMAPEVIACDENPDATYDYRSDLWSCGITAIEMAEGAPPLCDMHPMR
ALFLIPRNPPPRLKSKKWSKKFFSFIESCLVKNYTQRPPTEQLLKHPFIRDQPNERQVRI
QLKDHIDRTKKKRGEKDETEYEYSGSEEEEEDPPEQEGEPSSIVNVPGESTLRRDFIRLQ
QENKERSEALRRQQLLQEQQLREQEEYKRQLLAERQKRIEQQKEQRRRLEEQQRREREMR
RQQEREQRRREQEEKRRIEEMDRRRKEEEERRRAEDEKRRNDREQEYIRRQLEEEQRHLE
MLQEQLLREQAMLLADERYRKNIQGSPQAAPPPKQPPLPPRSSEPFSNGSSSSEAPAMQR
PMEPQVQWSHLAALKSSNSAAPSPPPPPPVVSRSQSFSESGSVTSSIAQLQLRSQDPHHH
HHHPSPARTDPQPQPPHHHHPQAQTRVEHQSSIEEVPPKVPVRTTSRSPVLSRRESPLPS
QTGNQGVQRIAGSNVEQRPLWDRVEKLQPRPGSGSSSGSSNSSAQASPADRFRPRCESPA
SSKSEGSPLQRPENVSKKQDEKNLVRPTRPAGDVDLTALAKELRAVDDVRPPHKVTDYSS
SSEESGTTDEEDDEEVDQEAGEESTSGAEDSRAGFPHGFRRRLSNGETESAKTMLVEDSE
NEQVTTPSKDGTLVIRQSTAEIKRLVSLSASASAGSGSGSGSASAHSLGLPLPPSHGLLE
KNGYPGRIHHLPDLIQQSHHPPSSTSSSMPPSSSSSSSFPSSSSHASPAMSPQTPLDKLT
AIESQSENNSMSKHKSSSSFTPFIDPRLLQISPSSGSSLNNMAGFGQDGRLMDPLRADPS
RKGSVVNVNPVNTRPPSDTPEIRKYKKRFNSEILCAALWGVNLLVGTESGLMLLDRSGQG
KVYPLISRRRIQQMDVLEGLNVLVTISGKKNKLRVYYLSWLRNKILHNDPEVEKKQGWVN
VGDLEGCVHYKVVKYERIKFLVLALKNSVEVYAWAPKPYHKFMAFKSFGDLVHKPLLVDL
TVEEGQRLKVIYGSSSGFHAVDVDSGAVYDIYLPTHIQTSIQCHAIIILPNTDGIELLVC
YEDEGVYVNTYGRITKDVVLQWGEMPTSVAYIRSNQIMGWGEKAIEIRSVETGHLDGVFM
HKRAQRLKFLCERNDKVFFASVRPGGASQVYFMTLGRTSLMSW
NT seq 4092 nt NT seq  +upstreamnt  +downstreamnt
atggcgaacgactctccagctaaaagtctagtagacatagacttggcttcattgcgggat
ccagccggaatatttgagttggtggaggtggttggaaatggtacctatggacaagtatac
aagggtcgacatgtcaagactggacagctggctgccatcaaagtcatggacgtcacagag
gacgaggaggaggaaattaaactggagatcaatatgctgaagaaatattcccaccacaga
aacattgccacctactatggtgctttcattaagaagagccccccagggcacgatgaccag
ctgtggctggtgatggagttctgtggcgcaggttcaatcacagacctggtgaagaacacc
aaggggaaccagctgaaggaagactggatcgcctacatctccagagaaatcctcagaggt
ctggcccacttacatgcccaccatgtcatccaccgtgacatcaagggccaaaatgtcttg
ttgacagagaatgcagaagtcaaattagtggattttggtgtcagtgctcagttagatcga
acagtgggcagaagaaacacatttattgggactccttattggatggcccctgaagttatc
gcttgtgacgagaacccagacgctacgtatgattacaggagtgacctgtggtcgtgtggt
atcacagctattgaaatggctgaaggagcaccacctctctgtgacatgcatccaatgcgt
gccctcttcctcattccaagaaatcctcctcctagactcaaatctaagaaatggtccaaa
aagttttttagtttcatcgagagctgcttggtgaagaactatacacagcgtccccctaca
gagcagctcctgaagcatcccttcatccgtgaccagcctaatgagaggcaggtccggatc
cagctcaaggaccacattgaccggaccaaaaagaagaggggagagaaagatgagacagag
tatgagtacagtggcagtgaggaggaggaagaagatcctccagagcaggaaggagaacct
agctccatagtcaatgttcctggtgagtcaactctacgacgcgacttcattcgccttcaa
caagaaaacaaggagcggtcagaggcattgcgtcgccagcagctcctccaggagcagcag
cttcgggagcaggaggagtacaagcgccagctcctggctgagaggcaaaaacgtattgag
cagcagaaggaacagaggaggcggctagaagagcaacaaagacgtgagcgtgagatgagg
aggcaacaggaacgagagcaacgtcgacgtgagcaagaggagaagagaagaattgaagaa
atggaccgaagacggaaagaagaagaagaacgacggcgggctgaggacgagaagaggagg
aacgatcgtgaacaggagtacatcaggcgtcagctggaagaggagcagagacacctggag
atgctgcaggagcaactgctccgtgaacaggccatgctgttggctgatgagcggtaccgt
aagaacattcagggatctcctcaggctgcccctcctcccaagcagccccctctgcctccc
cgctcctctgaaccgttctccaatggtagctcctcctctgaggccccagccatgcagcga
ccaatggagcctcaggtccagtggtcccaccttgctgctctaaaaagcagcaacagcgct
gctccctctcctcctcctcctcctcctgttgtgtctcgctcccagtccttcagtgaatct
ggcagtgtgacctctagcattgctcaactccagctgcgctcccaggacccccaccatcac
caccaccacccatcacctgcacgcactgacccccagccccaaccaccccaccaccaccac
cctcaggcccagaccagggttgagcaccagtctagcattgaggaggtgccacccaaggta
ccagtgaggactacatccaggtctccagtgctgtcccgcagagagtctcctttgccatca
cagactggaaaccagggggtgcagaggattgctggaagtaatgtggagcagcgccctctg
tgggaccgcgtggagaagctgcagcctcgacccggcagtggcagttcctctggctcctcc
aactccagcgctcaggccagtcctgcggaccgcttcaggccccgttgtgagtcccctgct
tcctccaaatctgaaggatctcctctccaaagaccagaaaatgtttccaaaaaacaagat
gaaaagaacctggtcaggccgactcgacctgcgggtgatgtggacctgactgctctcgcc
aaggagctccgtgctgtagatgatgtgcggcctcctcacaaagtcaccgactactcctcc
tccagcgaggagtcgggcaccactgacgaggaagatgatgaggaggtggatcaggaggcg
ggagaggagtcaacctcaggagcagaggattctagagctggatttcctcatggcttccgc
aggaggctgagtaatggggagacggagtcggccaagacaatgctggtggaggattctgag
aatgaacaagtgactacaccctccaaggacggcactctggtcatcagacagagcactgct
gaaattaagcggttggtcagtctctcggcctctgcttcagccggctctggctctggctct
ggctctgcctctgcccacagccttgggctgccactgccccccagtcacgggctgctagag
aaaaatggctacccaggtcgcatacaccaccttccagaccttatccagcagagccatcac
cctccttcctccacctcctcctccatgcctccctcctcctcctcctcatcctccttcccc
tcatcatctagccatgccagtcctgccatgtccccacagacccccttggacaagctcact
gccatagagtcccagtcagagaacaactccatgtccaaacacaagtcttcctcctccttc
acccccttcattgacccacgtcttcttcagatctctccttccagcggcagctctctcaac
aacatggccggatttgggcaagatggacgcctgatggacccactgagagccgatccgtct
cgaaagggctcagttgtcaacgtcaatccggtaaacactcgtccacccagtgacacacca
gagattagaaagtacaagaagaggtttaactctgaaatcctctgtgccgctctctggggg
gtgaacctgctagtggggacagagagtggtctgatgctgctggaccgaagtggtcaggga
aaagtctacccattgatcagcagacggcgaatccaacagatggatgttctggagggactc
aacgtcctggtcaccatatcaggtaaaaagaacaagctgcgtgtttactacctgtcatgg
ctcaggaacaagattttgcacaacgaccctgaggtagagaagaagcaaggttgggtcaac
gtgggcgacctggagggctgcgtccactataaagtcgtgaagtatgagagaattaagttc
ttggtgctggccttgaagaattctgtggaggtttatgcctgggctccaaagccgtaccat
aagttcatggcctttaaatcttttggtgatctggtgcacaagcctctgttggttgatcta
acggtagaagagggtcagaggttgaaggtcatctatgggtccagctctggcttccatgcc
gtggatgtggactctggggctgtgtatgacatctacctgcccacacatatccaaaccagc
atccagtgccatgccattatcatcttaccaaacactgatggaattgagctgcttgtgtgt
tacgaagatgagggtgtttatgtcaacacttatggacgcatcaccaaggacgtggtgctg
cagtggggagagatgccgacttcagtggcctacattaggtcaaaccagatcatgggctgg
ggtgagaaggctatagagatccgctctgtggagacaggacatctggacggtgtcttcatg
cacaagagggcacagagactcaagttcctgtgtgaaaggaatgacaaggtcttctttgcc
tcagtgcggcctggaggtgccagtcaggtgtacttcatgaccctgggtcgcacatcactc
atgagctggtag

DBGET integrated database retrieval system