KEGG   Cynoglossus semilaevis (tongue sole): 103389988
Entry
103389988         CDS       T04866                                 

Gene name
dck
Definition
(RefSeq) deoxycytidine kinase
  KO
K00893  deoxycitidine kinase [EC:2.7.1.74]
Organism
csem  Cynoglossus semilaevis (tongue sole)
Pathway
csem00230  Purine metabolism
csem00240  Pyrimidine metabolism
csem01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:csem00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    103389988 (dck)
   00240 Pyrimidine metabolism
    103389988 (dck)
Enzymes [BR:csem01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.74  deoxycytidine kinase
     103389988 (dck)
SSDB
Motif
Pfam: dNK AAA_33 AAA_18 AAA_28 AAA_17
Other DBs
NCBI-GeneID: 103389988
NCBI-ProteinID: XP_008323881
UniProt: A0A3P8VZU1
Position
14
AA seq 275 aa
MSYTSKRPCPDSLDCSMNDSVSDSLNDSMEKRIKRISVEGNIAAGKSTFVRLLEQESTDW
EVVPEPIARWCNVQTNGNDFEELTTSQKSGGNVLQMMYEKPERWAFTFQSYACISRVRAQ
IKSANGKLREAENPVQFFERSIYSDRYIFAANLYEAECLNETEWSVYQDWHGWLHSQFGK
HIELDGIIYLRASPKKCLERLHLRGRAEEQDIPLEYLEKLHFKHESWLQHKTMTMEYDYL
SDVPVLTLDVTEEFKADPTKCADMIEKVKEFLSTL
NT seq 828 nt   +upstreamnt  +downstreamnt
atgtcttacacttccaagagaccatgtcccgattcactggactgttctatgaacgactct
gtaagtgactcactgaacgactcgatggagaaaagaataaagcggatttcagtggaggga
aacattgcggcgggtaaatccacatttgtccgccttttggagcaggagagcacagactgg
gaagtagtaccagagcccatcgccaggtggtgcaatgtccaaacaaacggcaatgacttt
gaggagctgaccacatctcagaagagcggagggaacgtcctgcagatgatgtatgagaaa
cctgagaggtgggccttcactttccaaagctacgcctgcatcagcagggtgcgtgcccag
atcaagtcggcaaacgggaagctgagggaggcagagaatcctgtgcagttcttcgagcga
tctatttacagtgacaggtatatctttgcagccaacctgtatgaggctgagtgtctgaat
gaaactgaatggtctgtgtaccaggattggcatggatggctgcatagccagtttggcaag
cacatcgagctggacggtatcatctacctccgagcttcacctaagaaatgtttagagagg
ctgcacctgcgaggcagagcagaagagcaggacattcctctggagtatctggagaagctc
cactttaaacatgagagctggctgcagcacaagaccatgacaatggagtacgactacctg
agtgatgtgccagttttgaccttagatgtgactgaagaatttaaggcagatcccacaaag
tgtgctgatatgattgaaaaggtgaaagagttcctcagcacgctatag

DBGET integrated database retrieval system