KEGG   Cynoglossus semilaevis (tongue sole): 103390334Help
Entry
103390334         CDS       T04866                                 

Definition
(RefSeq) 5-hydroxytryptamine receptor 4-like
  KO
K04160  5-hydroxytryptamine receptor 4
Organism
csem  Cynoglossus semilaevis (tongue sole)
Pathway
csem04020  Calcium signaling pathway
csem04080  Neuroactive ligand-receptor interaction
Brite
KEGG Orthology (KO) [BR:csem00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04020 Calcium signaling pathway
    103390334
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    103390334
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:csem04030]
    103390334
G protein-coupled receptors [BR:csem04030]
 Rhodopsin family
  Biogenic amine
   Serotonin
    103390334
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_1 Gaa1 Corona_NS3b DUF2206 Saf_2TM E1-E2_ATPase T2SSF
Motif
Other DBs
NCBI-GeneID: 103390334
NCBI-ProteinID: XP_016893846
UniProt: A0A3P8WUL4
Position
14
AA seq 438 aa AA seqDB search
MATASPQQSLDDIIKTVLEDHHLQQQQQQQQQQEFLSSLETVVLTIFLSIIIIMTVFGNL
LVMVALCKDRHLRKKKTNYFIVSLAFADLLVAVVVMPFAAVELTTGQWRYGQIFCLVRTS
LDVLLTTASILHLCCIALDRYYAICCQPLVYSHKMTPVRVAVMLGSCWIIPTFISFLPIM
QNWNAIGIEDIIEERRALTGGSNDTSCVFLVNQPYALICSAVAFYVPLALMVLAYQRIYV
TATTHARQIETLQRAGSAPACGTARAVTVRSSTSSDPTELYRPRTRAGSPSTDQAAVVNS
RMRVETKAAKTLAVIMGCFCLCWAPFFITNVVDPFIHYSVPWQLWTAWLWLGYINSGLNP
FLYAFLNRAFRRAFLMILCCGDERYSRQGSCSYRQTHGSLNGTSMALRLSFLPNQSYSDH
GQTVLANEQESHDSLGKQ
NT seq 1317 nt NT seq  +upstreamnt  +downstreamnt
atggccacagcatcacctcaacagtctttggatgacatcataaaaacagtactggaagat
catcatcttcagcagcagcagcagcagcagcagcagcaggagtttctcagctcactggag
acagttgtcctcaccatcttcctctcaatcattattatcatgacagtcttcggaaacctg
ctggtcatggtggcactttgcaaagacagacatctgaggaagaagaaaacaaactacttc
atcgtgtctctggcgtttgccgatttgctagttgctgtggtggtgatgccctttgctgct
gttgagttgaccacgggtcagtggagatacggacagatcttctgcctggtgcgtacgtcg
ctggacgtcctgttgacaacagcgtccatcctgcacctctgctgcatcgcactggacaga
tactacgccatctgctgccagccgttggtctacagccataagatgaccccggtgagagtg
gcagtcatgctgggcagctgctggatcatccccaccttcatctccttcttacccatcatg
caaaactggaacgccatcggcatcgaggacattattgaagagaggcgagcgttgacggga
ggatccaacgacaccagctgtgtgttcctggtgaaccagccttatgccctcatctgttcg
gctgtagccttctacgtaccgctggccctcatggtcctggcgtaccagcgtatctacgtg
actgccacgacccacgccagacagatcgagacgttgcagcgcgccggctctgctcctgcg
tgtggaacggcacgggccgtcaccgtgagatcatctacttcttcagatccaacagaactc
taccggccgaggacaagagcaggttctccgtccacagaccaggctgctgttgtcaacagc
cgcatgagggtcgagactaaggcggcaaagacgctagcagttattatgggctgtttctgt
ctgtgttgggccccgttcttcatcactaacgtggtggaccccttcattcactactcagtg
ccctggcagctgtggaccgcctggctgtggctgggctacatcaactcagggttgaaccct
ttcctctacgccttccttaaccgagcgtttcgaagggcctttctgatgatcctttgttgt
ggagatgaaaggtactctcgtcaggggagctgctcctacagacaaacccacggatcgctc
aacggcacctccatggcattgaggctgtccttcctgcccaatcagagctacagtgaccac
ggacagaccgttctggccaatgagcaggagtcacatgattcccttggaaaacagtga

DBGET integrated database retrieval system