KEGG   Cynoglossus semilaevis (tongue sole): 103391176Help
Entry
103391176         CDS       T04866                                 

Definition
(RefSeq) cis-aconitate decarboxylase-like
  KO
K17724  aconitate decarboxylase [EC:4.1.1.6]
Organism
csem  Cynoglossus semilaevis (tongue sole)
Pathway
csem01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:csem00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00660 C5-Branched dibasic acid metabolism
    103391176
Enzymes [BR:csem01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.6  cis-aconitate decarboxylase
     103391176
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: MmgE_PrpD
Motif
Other DBs
NCBI-GeneID: 103391176
NCBI-ProteinID: XP_008325567
Position
15
AA seq 495 aa AA seqDB search
MISTLQKTFRTPWAVRGMHTSALAVLKQPAPEETVTASFGKFISDIKPQHLSPKVLQRSK
RMVLDSIGVGLIGSTTEVFGLALQHCQCMYAPDDTSSVYGRQGTKLSPTLAAFVNGVATH
SMDFDDTWHPATHPSGAVLPALLALSDMMPPNSKPSGLDLMLAFNVGIEIQGRLMRFSNE
ARNIPKRFHPPTVVGTMGSAAASARLLSLNPTQCSHALAIAASLSGAPMANAATQSKPLH
IGNASRLGLEAALLASRDLKGSALILDDVAGVSGFSAFYEDYASQHLESPSDDGHVFLLE
EQDMGFKRFPAHLGMHWVADAAASIQKRLIEVNAGPTLPAQIQEILLRVPKSKYINRPFP
ESEHEARHSFQFNACSALLDGEVTVRSFTPASMKRPELQALLGRVRLEHPCDNPANFNSM
YSEVQVTLAGGYILTARCDTFYGHWRNPLTNESLAKKFRSNAGMVLPSEKVEMLIDVVEE
LDKIGDCGVLLRQLQ
NT seq 1488 nt NT seq  +upstreamnt  +downstreamnt
atgatctccacactgcagaaaaccttcagaacaccctgggctgtcagagggatgcacacg
tcagcattagcagtcttaaagcagccggcaccagaggaaacagtcacggccagttttggg
aagttcatcagtgacattaagccccagcacttgtcccccaaagttctgcagcgcagcaaa
agaatggtgctggacagcattggggttggactcattggaagcacaacagaagtgtttgga
ctggctttgcagcactgccagtgcatgtacgctcctgacgacaccagctctgtgtacgga
cgccagggaaccaaactctcgccaacactggctgcttttgtcaacggagtggcgactcat
tcaatggactttgatgacacgtggcatcctgccactcacccctcaggagcagtcctccca
gctctgttagcgctcagtgacatgatgccgccaaacagcaaacccagcggcctggacttg
atgctggctttcaacgtgggcatcgagatccaggggcgactgatgagattctccaacgag
gcccgcaacatccccaagagattccaccctcccactgtggtaggaaccatgggaagtgca
gctgccagtgctcgactcctgtccctcaatcccacccagtgcagtcacgccttggccatc
gccgcctctctgtcaggagcccccatggcaaatgcggccactcagtctaagcccctccac
atcggcaacgcatcccgtctgggtctggaggcggctctgctggcctcccgagatctaaag
ggcagcgccctcatcctggacgacgtggcgggggtgtcaggcttcagcgccttttacgaa
gactacgcatcacagcatctagagtcacccagtgacgacggccatgtgttcctgctagag
gaacaagacatgggcttcaagcgcttccccgcccatctaggcatgcactgggtggcagac
gctgcagcctccatccagaagcgtctcatagaagtcaacgccggtcccaccctcccagct
cagatccaggaaatcctgctgagagtccccaaatccaagtacatcaaccggcctttcccg
gagtcggagcacgaggcacgccactccttccagttcaacgcctgcagcgctctcctcgac
ggtgaggtcacagtgcggtcattcaccccggcctccatgaaacgccccgagctgcaggct
ctgctcggtcgcgttcgtctcgagcatccttgtgacaacccagccaatttcaacagcatg
tacagcgaagtgcaggtgacacttgctggcggatacattctaacggcacgctgtgacacc
ttctacggtcactggcgtaaccctctgaccaatgagagcctggcaaagaagtttagaagc
aacgcagggatggtgctaccatcagagaaggtggagatgttgatagatgtggtggaggag
ttggacaaaatcggagactgtggtgttctactgagacaactgcaataa

DBGET integrated database retrieval system