KEGG   Cynoglossus semilaevis (tongue sole): 103391713
Entry
103391713         CDS       T04866                                 

Gene name
aff3
Definition
(RefSeq) AF4/FMR2 family member 3 isoform X1
  KO
K15195  AF4/FMR2 family member 3
Organism
csem  Cynoglossus semilaevis (tongue sole)
Brite
KEGG Orthology (KO) [BR:csem00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:csem03021]
    103391713 (aff3)
Transcription machinery [BR:csem03021]
 Eukaryotic type
  RNA polymerase II system
   Other transcription-related factors
    Others
     103391713 (aff3)
SSDB
Motif
Pfam: AF-4_C AF-4 AF4_int
Other DBs
NCBI-GeneID: 103391713
NCBI-ProteinID: XP_008326309
Position
16
AA seq 1207 aa
MPTVLGGRGQLSMVCFVLRCAYAQVTRSQHKSCAKDILEDMTQIWPSQQALGGDQSQRML
YNPKDAKQATATQRQSRGDVQLRMTRHPHVAPHKSMLADDLKLSSDDEDNQRATHESSAW
ERHSRSARRAQTHGRRVRHSSSDSSDSDYSGGGSGGGSSSLHSRSSSPEVHPDPASPASQ
PRNYKEVPGTSRPSTAHWQLDKWLQKSQRKSSSSDKAPSTSAAGRLPSPHPPSPLRSWDS
NQEYSPSQSPIPSPRLSYSNNNTPLPSPGYSYCPSPSPFPSTCPSPSPSPRHSSIPSPVP
SVCPSPCGSPQSSRSLSPISRDPPKSPSPSLPSPSRQRHYPESQTTHRSPQQSSQGVNLH
RTKIRSRTAPVVNSDSRNKVTDSSSGQLTSHHRPKTQPVRDKDQNPTKSKTSAVLTSDPH
HCQKNRPKSDFNPKPKQIPDAPKAKHSLHFENIQSNKSNHSSSHKPRPTFRPSSQVSPSR
TRQQGVASCEANTSHSSYSQCTSKSKQWKATAPTAVHDIHAKTSERRPHSKEREVDYRRD
RQSKVDRSKEESKEDRHRDKQRRTQDRKEDRRLAEEQLLRRSWIHTSEEEEEEEEEDGVL
ERLGRRREEVSKGENRRKEQQTEWQSVQTKQRLFTGDKQQRNRDNSHLDRATKKGGTSEK
AREPHQDPLPAHPSHSPTPHKPSSSSSSSSSNSDSESEYQVPVGKVPPDSTSQKSLRKSG
PNRPNTNRAEEGHSRGPISARSSDGKQKLYTLVPFGRSDQTAVPSNRGLRNLVVQIDLCL
LKRVPDNTANPTVKNPSATSTVSSSAKDKQKEAMKHLHIPESKRKRKLENGVSNRDSKKS
HPNTTDLSGRTVEPSTHAGERSFVTETTHNGYLDEYLDSKRPMSPLSPLSPLSLSPDTTK
PPPKTKSSEQHHNHPHKPRVRNNDPVKAQPKAEVECVKVSRQPHPPSETWGPAGHMGTAP
NHETPHHAEYYLHEAKRMKHRADAMVDKLGKAVNYVDAALSFMECGKAMEEGPLEAKSPY
TMYSETVELIRYAMRLKSHSGPGARQEDKQLAVLCFRCLALLYWQMFRLKKDHALKYSKV
LMDYFKSSPKVSAMPPGWNDSGKTAPPLSPNSKHHGHSSHGGSNSPSFISIPQRIHQMAA
NHLNITNSVLYSYEYWEVADNLAKENKEFFNYLNTLSGPLTLHSSIAHIVQYTRQALQWI
RISAKLN
NT seq 3624 nt   +upstreamnt  +downstreamnt
atgccgacggtgctcggtgggagagggcaactttccatggtctgttttgtgctccgatgc
gcatacgctcaggtaacaagaagccaacataagagttgtgccaaagatatcctggaggac
atgactcagatctggccatcccaacaggccttagggggggaccagtcccaaagaatgctc
tacaaccccaaggatgctaaacaggcaactgcaacacaaagacaaagtcggggagatgtt
cagctcagaatgacccgtcaccctcacgtggcacctcacaaatccatgcttgccgatgac
ctgaagctgagcagtgacgacgaagacaatcaaagggccacacacgagtcgtctgcctgg
gagagacacagccggtcagcacggcgagcacaaacacatggcagacgggtgagacattcc
agctctgattcttcagactcagactacagtggtggtggcagcggcggtggaagcagcagc
cttcattcacgtagctcgagtcctgaagttcatcctgatcctgcatcgcctgcatcgcaa
cctcgcaactacaaggaggtaccaggaaccagtcgtccctctactgctcattggcagttg
gataaatggctgcagaagtctcagagaaagtcaagcagtagtgacaaagctccttccacg
agtgctgcaggacgtctgccttctcctcaccccccttctcccctaaggtcctgggacagc
aatcaggaatacagtcccagccaaagcccaattcccagcccacggttgagttacagcaac
aacaatacacctcttcccagtcctggttatagctactgcccgagcccaagccctttccct
agtacctgtccaagtcccagtcctagtccaaggcacagctcgattcccagtccggttcca
agtgtatgtcccagtccttgtggaagtccacaaagcagcaggagtctgagtccaatatct
agagatcctccaaaaagcccaagtccaagcttaccttctccttcaaggcagcgtcactac
cctgagagtcagacgacccaccgcagcccacagcaatcgagtcagggagtcaatctacac
aggacgaaaatcaggtctcggactgcgcctgtggtgaacagtgactcaaggaacaaggtc
acagatagcagcagtggtcagctgacttcccaccacaggcctaagactcaacctgtacgt
gataaggatcaaaacccgactaaatccaagacctcggctgttttaacctctgacccgcat
cattgccaaaaaaatagacccaagtcagattttaatccaaaaccaaaacagatcccagat
gctccaaaggccaaacactcactacattttgaaaatatacaaagtaacaaatctaaccat
agctccagccataagcccagacctacgtttagacccagctcacaagtaagcccctctaga
acgaggcagcagggtgttgctagttgtgaagccaacacaagtcacagttcatactcacag
tgtacctcaaaatccaagcagtggaaggctacggcgccgaccgctgtccatgacattcat
gcaaaaacctcagagaggagaccacacagcaaggaacgggaggtggactacagaagagac
cgtcagagtaaagtagaccggagtaaagaggagagcaaggaggacaggcatcgggacaaa
cagagaagaacacaggacaggaaggaagacaggaggctggcggaggaacagttattaaga
cgttcctggatccacacttcagaagaagaggaagaggaggaggaggaagacggtgtacta
gagaggctaggcaggagaagagaggaggtttccaaaggtgaaaacagacggaaggagcag
caaactgaatggcaatcagtccaaaccaaacagagattgtttacaggtgacaaacaacaa
cgaaatagggacaactcacacctcgacagggcaacaaaaaagggagggaccagtgagaag
gccagagaaccacatcaagaccctttgcccgctcatccttcacactccccaaccccccat
aagccatcctcctcatcctcttcttcatcctctaactcagattcagaatctgagtatcag
gttcccgtcggcaaagttccaccagattccacctcccaaaagtcactcaggaagagtggt
ccaaacagacccaacaccaatagggccgaggaaggacactccagagggcctatctccgcg
aggtccagtgatggaaagcagaagctctacaccttggtcccttttgggagaagtgatcag
acggcagttccctctaatcgagggctgaggaacctggtggttcagatagacctttgtctc
ctcaaaagggtcccagacaacactgcaaaccccacagtcaaaaacccttcagcgacctcc
accgtctcttcatcggctaaggacaaacagaaagaggccatgaaacacctgcatatacct
gagagcaaaaggaaacgtaagctggagaacggcgtgtcaaacagggacagcaagaagagt
catcctaacacgactgacctctcaggtcgaacggttgagccctcaactcatgcaggagag
cgcagctttgtgacggagaccacacacaatgggtatttggatgagtacttggacagcaag
aggccaatgtctccactgtccccactgtccccactgtccctcagcccagacaccaccaag
cctccacccaaaacaaagagctcggagcagcatcacaaccacccccacaagcccagagtc
agaaataatgatcctgtgaaggcccagcccaaagcagaggtggaatgtgtaaaagtgtcc
agacagccccatcccccatcagaaacctggggccctgcaggacacatggggactgcacct
aaccatgaaacgccacaccatgctgagtactatttacatgaagcaaaaaggatgaagcac
cgtgcagatgcgatggtggataagcttgggaaggcggtgaactatgttgatgccgctctg
tccttcatggaatgtggaaaagcgatggaggaaggaccactggaggctaaatctccatat
accatgtattcagagacagtggagctcataaggtacgcaatgaggctaaagagccactct
ggccccggggcaaggcaggaggacaaacagctagcggttctctgttttcgatgccttgcg
ctgctttactggcagatgtttcgacttaagaaagaccacgctctgaaatactccaaagtg
ctgatggactactttaagagttctcccaaagtgtctgcaatgccacccggttggaacgac
tcaggaaagaccgcgccacctctctcgcctaattccaaacaccatggacacagttcacat
ggaggcagcaactccccatcctttataagcattccccaacgtatccaccagatggcagca
aatcacttaaacatcaccaacagcgtcctgtacagctatgagtattgggaggtggctgac
aaccttgcaaaggagaacaaagagttcttcaactacttgaatacgttatcggggccattg
actcttcacagcagcattgcccacatagtccagtacaccaggcaggctcttcagtggata
cgtatcagtgccaaacttaactaa

DBGET integrated database retrieval system