KEGG   Cynoglossus semilaevis (tongue sole): 103392312Help
Entry
103392312         CDS       T04866                                 

Gene name
dars
Definition
(RefSeq) aspartate--tRNA ligase, cytoplasmic
  KO
K22503  aspartyl-tRNA synthetase [EC:6.1.1.12]
Organism
csem  Cynoglossus semilaevis (tongue sole)
Pathway
csem00970  Aminoacyl-tRNA biosynthesis
Brite
KEGG Orthology (KO) [BR:csem00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    103392312 (dars)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:csem01007]
    103392312 (dars)
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:csem03016]
    103392312 (dars)
Enzymes [BR:csem01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.12  aspartate---tRNA ligase
     103392312 (dars)
Amino acid related enzymes [BR:csem01007]
 Aminoacyl-tRNA synthetase
  Class II (A)
   103392312 (dars)
Transfer RNA biogenesis [BR:csem03016]
 Eukaryotic Type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    103392312 (dars)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: tRNA-synt_2 tRNA_anti-codon
Motif
Other DBs
NCBI-GeneID: 103392312
NCBI-ProteinID: XP_008327117
UniProt: A0A3P8W8D9
Position
16
AA seq 531 aa AA seqDB search
MTKEEVQGAAEEDQQVQSKKGLKKQQKEAEKAAKKAEKQAKLAAEQQGSEEDDFSKDRYG
VSAMVQSQQKLDRTLTRVQDLTTERADQLIWLRARVHTSRAKGKQCFLVLRQQQFNVQAL
VAVGDRASKQMVKFAANVTKESIVDVEAVVRKVEQKIESCTQQDVELHIERIFVISQAEP
RLPLQLDDAVRAEGEGEEEGRATVNQDTRLDNRVIDLRTTTSQAVFRLQSGVCQLFRDTL
TNKGFVEIQTPKIISAASEGGANVFTVSYFKTSAYLAQSPQLYKQMCICADFDKVFCVGP
VFRAEDSNTHRHLTEFVGLDIEMAFNYHYHEVIDSITDTMVQIFKGLQDNFQTEIQTVNK
QFPSEPFKFLEPTLRLEYKEGVAMLREAGVEMGDEEDLSTPNEKLLGRLVKEKYDTDFYV
LDKYPLAVRPFYTMPDPNDPKYSNSYDMFMRGEEILSGAQRVHDAQLLTERAIHHQIDLE
KIKAYIDSFRYGAPPHGGGGIGLERVCMLYLGLHNVRQTSMFPRDPKRLTP
NT seq 1596 nt NT seq  +upstreamnt  +downstreamnt
atgactaaggaggaagtccagggggcggccgaggaggatcagcaggtccagtcaaagaag
ggcctgaagaaacagcagaaggaagcagagaaagctgcgaagaaggctgagaaacaggcc
aagctggctgctgaacaacaaggctcagaggaagatgacttttccaaggaccgatacggt
gtttcagccatggtccagtctcaacaaaaactggacaggacgttgactcgagtccaagat
ctgacgactgagcgagcggaccagctgatctggctgcgggccagagtccacaccagcaga
gccaaagggaagcaatgctttctggtcctgcgtcagcagcagttcaacgtgcaggcgctc
gttgcagtgggagatcgtgccagcaagcagatggtcaagtttgctgcaaacgtcaccaag
gagagcatcgtggacgtggaggccgtggtgaggaaggtggagcagaagatcgagagctgc
actcagcaggacgtggagctccacatcgagaggatttttgtcatcagccaggcagagcca
cgtctccccctgcagttggatgatgctgtcagagctgagggagagggcgaggaggaaggc
agagccacggtcaaccaggacaccagactggacaacagagtgatcgatctcaggaccacc
accagccaggccgtcttccggctgcagtcgggagtctgccagctcttcagagacactctc
acaaacaagggctttgtggagatccagaccccaaaaatcatatcagctgccagtgaaggt
ggagccaacgtcttcactgtgtcctactttaagaccagcgcctacttggcccagtcccct
cagctctacaaacagatgtgtatctgtgctgactttgacaaggtcttctgtgtgggacca
gttttcagggcggaggactccaacactcaccgccacttgactgaatttgtgggtctggat
atcgaaatggcgtttaactaccactaccacgaggtcatcgactccatcactgacaccatg
gtccagatctttaaaggccttcaagacaacttccagactgagatccaaactgtcaacaag
cagtttcccagcgaacctttcaagttcctggagccgactctgaggttggagtacaaggag
ggcgtggccatgctgcgtgaggccggcgtggagatgggggacgaagaagacctcagtaca
cccaatgaaaagctgctgggtcgtctggtcaaggaaaagtacgacaccgacttctacgtc
ctggataaatacccactggctgtgagacctttctacaccatgcctgatccaaacgaccct
aaatattccaactcctacgacatgttcatgaggggggaggagatcttgtctggagctcag
agagtccacgatgctcagctgctcaccgagagagcaatccatcaccagattgatctggag
aagatcaaggcctacatcgactccttccgctacggtgctccccctcatggtggtggaggt
attggtctggagagagtctgcatgttgtacctgggtcttcacaacgtgcgtcagacctcc
atgttcccacgtgacccaaagcgtctcacaccctga

DBGET integrated database retrieval system