KEGG   Cynoglossus semilaevis (tongue sole): 103393017Help
Entry
103393017         CDS       T04866                                 

Definition
(RefSeq) voltage-dependent calcium channel gamma-5 subunit
  KO
K04870  voltage-dependent calcium channel gamma-5
Organism
csem  Cynoglossus semilaevis (tongue sole)
Pathway
csem04010  MAPK signaling pathway
csem04260  Cardiac muscle contraction
csem04261  Adrenergic signaling in cardiomyocytes
Brite
KEGG Orthology (KO) [BR:csem00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    103393017
 09150 Organismal Systems
  09153 Circulatory system
   04260 Cardiac muscle contraction
    103393017
   04261 Adrenergic signaling in cardiomyocytes
    103393017
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:csem04040]
    103393017
Ion channels [BR:csem04040]
 Voltage-gated cation channels
  Calcium channel, voltage-gated (Cav)
   103393017
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PMP22_Claudin Claudin_2 COPI_assoc DUF716 FtsX SUa-2TM
Motif
Other DBs
NCBI-GeneID: 103393017
NCBI-ProteinID: XP_008328037
Position
17
AA seq 276 aa AA seqDB search
MSACSRKALTLLSSVFAISSLGLLGVAVSTDYWLYLEEGVITPMNQSTDVKTSLHSGLWR
VCFLVGEESGRCFTIEYVMPISVQLTSESTVNLLKMIRSATPFPLVSLFFMFIGFVLSNI
GHVRPHRTILAFVSGIFFILSGLALVVGLVLYISSINDEMLNRTKSSEAYFTYKYGWSFA
FAAFSFLLTESAGVMSVYLFMKRYSAEEMYQPNHPSFYHPRLSNCSDHSGQFLHPDAWSR
GRSPSDISSEASLQMSSSYPALLKCPDYDQVSSSPC
NT seq 831 nt NT seq  +upstreamnt  +downstreamnt
atgagtgcgtgcagcaggaaagctctgactcttctcagcagcgtctttgcgatcagcagc
ctgggtttactgggcgtggccgtcagcaccgactactggttgtacctggaggaaggcgtc
atcacgccgatgaaccagagcacagacgtgaagacctccctgcactcgggcctctggagg
gtctgcttcctcgttggtgaagagtctgggcgatgcttcaccatcgagtacgtcatgccc
atcagtgtccagctgacgtcagagtccacagtcaacctgctcaagatgatccgttcagcc
acgccctttcctctggtcagcctcttcttcatgttcatcggttttgttctcagcaacatc
ggacatgttcggcctcatcgcaccatcctggccttcgtgtcgggaatcttcttcatcctc
tcaggtctggccctggtggtgggcctggtcctctacatatccagcatcaatgatgagatg
ttgaacaggaccaaaagcagtgaagcctacttcacctataaatacggctggtccttcgcc
tttgctgcgttctccttcctgctcaccgagagtgcaggtgtcatgtccgtctacctgttc
atgaaacgttactcagccgaggagatgtaccaacccaaccatcccagtttctaccaccca
cgtctcagcaactgctccgaccactcgggccagttcctccaccctgacgcctggtctcgt
ggacgcagcccctcagacatctccagtgaggcttctctgcagatgagcagcagctatcct
gccctcctcaaatgtcccgactacgatcaggtgtcctcgtcaccctgctga

DBGET integrated database retrieval system