KEGG   Cynoglossus semilaevis (tongue sole): 103393167Help
Entry
103393167         CDS       T04866                                 

Gene name
gpx2
Definition
(RefSeq) glutathione peroxidase 2
  KO
K00432  glutathione peroxidase [EC:1.11.1.9]
Organism
csem  Cynoglossus semilaevis (tongue sole)
Pathway
csem00480  Glutathione metabolism
csem00590  Arachidonic acid metabolism
csem01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:csem00001]
 09100 Metabolism
  09103 Lipid metabolism
   00590 Arachidonic acid metabolism
    103393167 (gpx2)
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    103393167 (gpx2)
Enzymes [BR:csem01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     103393167 (gpx2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GSHPx
Motif
Other DBs
NCBI-GeneID: 103393167
NCBI-ProteinID: XP_008328289
Position
1
AA seq 191 aa AA seqDB search
MTFIAKTFYDLKATTVEGDPVDFNVYRGRVVLIENVASLUGTTTRDFHELNQLQSKYPHR
LVVLGFPCNQFGYQENCSNSEILSSLQHVRPGGGFRPNFTIFQKCDVNGANTHPVFAYLK
DKLPYPDDDPNSLMLDPKFLVWSPVNRTDVSWNFEKFVIGPEGEPFKRYSKKFPTIDIEP
DIQRLLKLTKS
NT seq 576 nt NT seq  +upstreamnt  +downstreamnt
atgacgttcatcgccaagaccttctacgacctgaaggccaccaccgtggagggcgacccg
gtggacttcaacgtgtaccggggccgggtggtcctgatagagaacgtggcgtccctctga
ggtaccaccacccgggacttccacgagctgaaccagctccagagcaagtacccgcatcgg
ctggtggtcctgggtttcccctgtaaccagtttggatatcaggagaactgctccaacagt
gagatcctgagttctctgcagcacgtgcgtcccggcggcggcttcaggcccaacttcacc
atctttcagaagtgtgacgtaaacggagcgaacacgcacccggtctttgcctatctgaaa
gacaagctcccctatcccgatgacgaccccaactccctcatgctggaccccaaatttctg
gtttggagtcccgtcaacaggacagatgtgtcatggaactttgagaagtttgtcatcggc
ccagaaggagagccgttcaaaagatacagcaaaaagttccccacaatcgatattgagccc
gacatccaaagactgttaaagctaactaagagctaa

DBGET integrated database retrieval system