KEGG   Cynoglossus semilaevis (tongue sole): 103393236Help
Entry
103393236         CDS       T04866                                 

Gene name
cacng3
Definition
(RefSeq) voltage-dependent calcium channel gamma-3 subunit
  KO
K04868  voltage-dependent calcium channel gamma-3
Organism
csem  Cynoglossus semilaevis (tongue sole)
Pathway
csem04010  MAPK signaling pathway
csem04260  Cardiac muscle contraction
csem04261  Adrenergic signaling in cardiomyocytes
Brite
KEGG Orthology (KO) [BR:csem00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    103393236 (cacng3)
 09150 Organismal Systems
  09153 Circulatory system
   04260 Cardiac muscle contraction
    103393236 (cacng3)
   04261 Adrenergic signaling in cardiomyocytes
    103393236 (cacng3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:csem04040]
    103393236 (cacng3)
Ion channels [BR:csem04040]
 Voltage-gated cation channels
  Calcium channel, voltage-gated (Cav)
   103393236 (cacng3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PMP22_Claudin Claudin_2
Motif
Other DBs
NCBI-GeneID: 103393236
NCBI-ProteinID: XP_008328346
UniProt: A0A3P8WV02
Position
17
AA seq 317 aa AA seqDB search
MKMLMCDRGVQMLVTTVGAFAAFSLMTIAVGTDYWLYSRGVCRVKSSGDNDTSRKNEEVM
THSGLWRTCCLEGTFRGVCKKIDHFPEDADYEADAAEYLLRAVRASSIFPIMSVGLLFLG
GLCVAASEFYRSRHNVILSAGIFFVSAGLSNIIGIIVYISANSGDPGQSDSKKSYSYGWS
FYFGALSFIMAEMVGVLAVHMFIEKHRKQRAKSRTELIKKSTFSRIPSYRYRFRRRSSVR
SSEAPSRDTSPLGKGGYTGPAASELPMYTLNPREAGNAGTKAGGGMGGLLNSERDFLQSS
TLTKDYSKDPNRRTTPV
NT seq 954 nt NT seq  +upstreamnt  +downstreamnt
atgaagatgctgatgtgtgaccgcggcgtccagatgctggtaaccaccgtgggcgcgttc
gccgccttcagcctcatgaccatcgccgttggcaccgactactggctgtactcgcgtggg
gtctgccgcgtgaagagcagcggcgacaacgacacgagccgcaagaacgaggaggtgatg
acgcactccggcctctggcgaacttgctgtctggaaggaaccttcagaggagtgtgtaag
aagatcgaccactttccagaagatgctgattatgaagcagacgctgcagaatacctcctc
cgtgcagtgcgagcctccagtatcttccccatcatgagcgtgggcctgttgttcctggga
ggcctgtgtgtagctgccagtgagttttaccggagtcgacacaacgtcatcctcagcgct
ggaattttctttgtttccgcaggcctcagtaacatcattggaattatagtttacatctcg
gccaactcgggcgacccaggtcagagcgacagtaaaaagtcctactcctacggctggtct
ttctactttggcgccctctccttcatcatggcagaaatggtgggcgtgctcgccgtccac
atgttcatcgagaaacatcgcaagcagcgggccaagtcccgcaccgagctcatcaagaag
tccaccttcagccgcatcccgtcctaccgctaccgcttccggcgccgctccagcgttcga
tcttctgaggcccccagccgtgacacgtcaccgctggggaaaggcggctacacggggccc
gccgcttccgagttgcccatgtacacgctgaacccccgcgaagcgggcaacgccggcacc
aaagcaggcggcgggatgggcggcctgctcaactcagagagggatttcctccagagcagc
acgctcactaaagactacagcaaggaccccaaccgcaggaccacgcccgtgtga

DBGET integrated database retrieval system