KEGG   Cynoglossus semilaevis (tongue sole): 103394887
Entry
103394887         CDS       T04866                                 

Gene name
tm7sf2
Definition
(RefSeq) delta(14)-sterol reductase
  KO
K00222  Delta14-sterol reductase [EC:1.3.1.70]
Organism
csem  Cynoglossus semilaevis (tongue sole)
Pathway
csem00100  Steroid biosynthesis
csem01100  Metabolic pathways
Module
csem_M00101  Cholesterol biosynthesis, squalene 2,3-epoxide => cholesterol
Brite
KEGG Orthology (KO) [BR:csem00001]
 09100 Metabolism
  09103 Lipid metabolism
   00100 Steroid biosynthesis
    103394887 (tm7sf2)
Enzymes [BR:csem01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.70  Delta14-sterol reductase
     103394887 (tm7sf2)
SSDB
Motif
Pfam: ERG4_ERG24 DUF1295 ICMT PEMT
Other DBs
NCBI-GeneID: 103394887
NCBI-ProteinID: XP_008330565
UniProt: A0A3P8WHK1
Position
19
AA seq 425 aa
MEPNSKETKHRPSNSTEQEFGGTLGAVFIPIFLPLTVLSLICLCQSPEASVFQWPPPLPS
TERLWNPVAPVILLGWLALHALLYLLPLGKVSEGLVLRDGTRLKYPINGFHGLCVTSVLL
MLSLVLGAPFGYLFELLLPLAVCATVLSFLLATYLYIRSFSAPPHALAPGGNTGNPLYDF
YIGRELNPRIGNFDLKYFCELRPGLIGWVVINLGMLMKEVELRGSPSLAMILVNSFQLLY
VTDALWNEEAVLTTMDIVHDGFGFMLAFGDLAWVPFTYSLQAIFLVMHPQHLSLLRAAAI
ITLNGIGYYIFRKSNSQKNQFRRDPTHPSVAKLETIATATGKRLLVSGWWGLVRHPNYLG
DLAMAFAWSLPCGFSHLLPYFYVTYFTILLIHRESRDERQCRAKYGKAWESYCQRVPYRI
FPYIY
NT seq 1278 nt   +upstreamnt  +downstreamnt
atggagcccaacagtaaggaaaccaaacacagaccttcaaacagtacagaacaggagttc
ggaggaactttgggtgcagttttcataccaatctttctccccttaactgtgctgtcactg
atctgcttgtgtcagtcccccgaggcctccgtctttcagtggcctcctccactcccatcc
actgaaagactgtggaatcctgtggccccagtgatactgctgggatggcttgctcttcat
gctcttctctatctgctgccattggggaaggtgtctgaaggattagtgctcagagatgga
acgcgcctcaagtatcccattaatggtttccatggcctgtgtgttaccagcgtgttgctg
atgctgtctctggtgctcggcgctccctttgggtatctgtttgagcttcttttgcctctg
gcagtatgtgcaacagtactgtcatttctgctcgccacctacctctacatccgctctttc
tcggctcctccccacgctcttgctccgggggggaacaccggaaacccattgtatgacttt
tatatcggacgagagttaaatccccggattggaaactttgatctcaaatatttctgtgag
ctcagaccaggtctgattggctgggtggtcataaacctgggcatgttgatgaaagaggtg
gagcttcgaggttctccttccctggccatgatcctggtgaacagtttccagctgctttat
gttacagatgctctgtggaatgaggaagcagttctgactaccatggacattgtgcatgat
ggttttggcttcatgctggcctttggtgacctggcctgggttccgtttacatacagcctg
caggcaatatttctggtcatgcatccacagcacctaagcctcctcagagctgcagctata
atcacactgaatggtattggatattacattttcagaaaatccaactcacagaaaaaccag
tttagacgagatcccacacatccaagtgttgcaaaactggagacaatcgccacagcaaca
gggaagcggttgcttgtgtctggttggtggggtcttgtccgtcatcccaattatctcggt
gacctggccatggcctttgcctggtccctgccatgtggattctcacacctgctgccttac
ttttatgtcacatatttcaccatattgctgatacaccgagaatcccgcgacgagcgacag
tgcagggctaaatacggaaaggcgtgggaatcctactgccaacgtgttccgtataggatt
ttcccgtacatatactga

DBGET integrated database retrieval system