KEGG   Cynoglossus semilaevis (tongue sole): 103395051Help
Entry
103395051         CDS       T04866                                 

Definition
(RefSeq) LOW QUALITY PROTEIN: heat shock cognate 71 kDa protein
  KO
K03283  heat shock 70kDa protein 1/2/6/8
Organism
csem  Cynoglossus semilaevis (tongue sole)
Pathway
csem03040  Spliceosome
csem04010  MAPK signaling pathway
csem04141  Protein processing in endoplasmic reticulum
csem04144  Endocytosis
Brite
KEGG Orthology (KO) [BR:csem00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    103395051
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    103395051
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    103395051
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    103395051
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:csem01009]
    103395051
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:csem03041]
    103395051
   03009 Ribosome biogenesis [BR:csem03009]
    103395051
   03110 Chaperones and folding catalysts [BR:csem03110]
    103395051
   04131 Membrane trafficking [BR:csem04131]
    103395051
   03051 Proteasome [BR:csem03051]
    103395051
   03029 Mitochondrial biogenesis [BR:csem03029]
    103395051
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:csem04147]
    103395051
Protein phosphatases and associated proteins [BR:csem01009]
 Protein serine/threonine phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-5
    PP5-interacting proteins
     103395051
Spliceosome [BR:csem03041]
 Complex B
  Other components
   Prp19 complex
    103395051
 Complex C
   Prp19-CDC5 complex
    103395051
Ribosome biogenesis [BR:csem03009]
 Eukaryotic type
  Pre-60S particles
   Export and cytoplasmic maturation factors
    103395051
Chaperones and folding catalysts [BR:csem03110]
 Heat shock proteins
  HSP70 / DNAK
   103395051
Membrane trafficking [BR:csem04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Other core components
    103395051
 Autophagy
  Chaperone mediated autophagy (CMA)
   Chaperones
    103395051
Proteasome [BR:csem03051]
 Eukaryotic proteasome
  Assembling factors
   Other assembling factors
    103395051
Mitochondrial biogenesis [BR:csem03029]
 Mitochondrial protein import machinery
  Endoplasmic reticulum membrane and cytosol
   Other ER-memrane and cytosol factors
    103395051
Exosome [BR:csem04147]
 Exosomal proteins
  Proteins found in most exosomes
   103395051
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: HSP70 MreB_Mbl BcrAD_BadFG FGGY_C DDR
Motif
Other DBs
NCBI-GeneID: 103395051
NCBI-ProteinID: XP_008330835
Position
19
AA seq 679 aa AA seqDB search
MSKGAAVGIDLGTTYSCVGVFQHGKVEIIANDQGNRTTPSYVAFTDTERLIGDAAKNQVA
MNPTNTVFDAKRLIGRRFEDPVVQSDMKHWPFDVISDSGRPKVEVEYKGETKTFYPEEIS
SMVLTKMKEIAEAYLGKSVSNAVITVPAYFNDSQRQATKDAGTISGLNVLRIINEPTAAA
IAYGLDKKVGAERNVLIFDLGGGTFDVSILTIEDGIFEVKSTAGDTHLGGEDFDNRMVNH
FITEFKRKFKKDISDNKRAVRRLRTACERAKRTLSSSTQASIEIDSLYEGVDFYTSITRA
RFEELNADLFRGTLGPVEKSLQDAKMDKGKVHDIVLVGGSTRIPKIQKLLQDFFNGKELN
KSINPDEAVAYGAAVQAAILCGDKSENVQDLLLLDVTPLSLGIETAGGVMTVLIKRNTTI
PTKQTQTFTTYSDNQPGVLIQVYEGERAMTKDNNLLGKFELTGIPPAPRGVPQIEVTFDI
DANGIMNVSAADKSTGKENKITITNDKGRLSKDDIERMVQEAEKYKAEDDVQRDKVSAKN
GLESYAFNMKSTVEDEKLAGKISDEDKQKILDKCNEVISWLDKNQTAEKDEYEHQQQELE
KVCSPIITKLYQSAGGMPGGCPVGCQETSLERLVLLQVEDPLGQLLRRSINLWHLQQILY
TTGKMNKHEHDHKYDCTMD
NT seq 2040 nt NT seq  +upstreamnt  +downstreamnt
atgtctaaaggagcagcagtcggtattgatctcgggaccacctactcctgtgttggtgta
ttccagcatggcaaagttgaaatcattgccaatgaccagggcaacaggaccacacccagc
tacgtggccttcactgacacagagaggctgattggagatgcagccaagaatcaggttgca
atgaatcccaccaacacagtatttgatgccaaacgattgattggcagaagatttgaggat
ccagttgttcagtctgacatgaagcattggccattcgatgtcattagtgacagtgggcgc
cccaaagtggaagtcgagtacaaaggtgaaaccaaaacattctacccagaggagatttca
tccatggtgctaactaagatgaaggagattgctgaagcctacctgggaaaatctgtgtca
aatgccgtcatcactgttcctgcatacttcaatgactctcaacgccaagcaaccaaagac
gctggaacaatctctggccttaatgtattgagaattattaatgagcccactgcagctgcc
attgcctatggtttggacaagaaggtcggagcagagaggaacgtcctcatctttgatctt
ggtggcggcaccttcgatgtatccatcctgaccatagaggatggtattttcgaggtcaaa
tccacagcaggagacactcatcttggtggggaagactttgacaaccgcatggtaaaccat
ttcatcacagaattcaaacgcaagttcaagaaagacatcagtgacaacaagagggctgtt
cgtcgtctgcgtactgcctgtgagagggccaagcgcacactgtcctctagcactcaggcc
agcatcgaaatcgactccctgtacgagggagttgacttctacacatccatcaccagggct
cggtttgaagagctcaatgctgatctcttccgtggcaccttgggccctgtggagaagtct
ctccaggatgcaaagatggataaggggaaggtccatgacatcgtgttggttggtggttcc
acccgtatccccaaaatccagaagctgctccaggactttttcaatggaaaggagctcaac
aagagcatcaatccagatgaggcagtggcctatggcgctgctgtccaggctgccattctg
tgcggagacaagtctgagaatgtgcaggacctgctgcttctggatgtcacccctctgtcc
ctgggtattgagactgctggaggtgtgatgactgtcctgatcaagcgtaacaccaccatt
cccaccaagcagacccagacctttaccacctactcagacaaccagcctggtgtcctcatt
caggtgtacgagggtgaacgtgcaatgaccaaagacaacaatttgttgggtaaatttgag
ctgacgggcatcccccctgctccccgtggtgttcctcagattgaagtgacatttgatatt
gatgccaatggcattatgaatgtctctgctgctgacaagagcactggaaaggagaacaag
atcaccatcaccaacgacaaaggtcgactcagcaaggacgacatagagcgcatggtccag
gaagctgagaaatacaaagccgaggatgacgtgcagcgtgacaaggtgtctgctaagaac
ggcctggagtcctatgcttttaatatgaagtccactgtggaggatgagaaacttgctggc
aagatcagcgacgaggacaaacagaagattttggataaatgcaatgaagtcatcagctgg
cttgacaagaaccagactgcagagaaagacgaatatgaacatcagcaacaggagctggaa
aaggtgtgtagccccatcatcaccaagttgtaccagagtgctggaggaatgcctggaggt
tgcccggtgggatgccaggaaacttccctggagcggctggtgcttctgcaggtggaggat
ccactgggccaactattgaggaggtcgattaatctgtggcatctgcagcagatattgtac
accactggaaaaatgaataagcatgaacatgaccataagtatgactgtacgatggattaa

DBGET integrated database retrieval system