KEGG   Cynoglossus semilaevis (tongue sole): 103395269Help
Entry
103395269         CDS       T04866                                 

Gene name
pla2g4a
Definition
(RefSeq) cytosolic phospholipase A2 isoform X1
  KO
K16342  cytosolic phospholipase A2 [EC:3.1.1.4]
Organism
csem  Cynoglossus semilaevis (tongue sole)
Pathway
csem00564  Glycerophospholipid metabolism
csem00565  Ether lipid metabolism
csem00590  Arachidonic acid metabolism
csem00591  Linoleic acid metabolism
csem00592  alpha-Linolenic acid metabolism
csem01100  Metabolic pathways
csem04010  MAPK signaling pathway
csem04217  Necroptosis
csem04270  Vascular smooth muscle contraction
csem04370  VEGF signaling pathway
csem04912  GnRH signaling pathway
Brite
KEGG Orthology (KO) [BR:csem00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    103395269 (pla2g4a)
   00565 Ether lipid metabolism
    103395269 (pla2g4a)
   00590 Arachidonic acid metabolism
    103395269 (pla2g4a)
   00591 Linoleic acid metabolism
    103395269 (pla2g4a)
   00592 alpha-Linolenic acid metabolism
    103395269 (pla2g4a)
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    103395269 (pla2g4a)
   04370 VEGF signaling pathway
    103395269 (pla2g4a)
 09140 Cellular Processes
  09143 Cell growth and death
   04217 Necroptosis
    103395269 (pla2g4a)
 09150 Organismal Systems
  09152 Endocrine system
   04912 GnRH signaling pathway
    103395269 (pla2g4a)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    103395269 (pla2g4a)
Enzymes [BR:csem01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.4  phospholipase A2
     103395269 (pla2g4a)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PLA2_B C2
Motif
Other DBs
NCBI-GeneID: 103395269
NCBI-ProteinID: XP_008331149
Position
2
AA seq 752 aa AA seqDB search
MMTDVMDLLQVEQQFSHKFTVNVVSAENVTKGALGDLLDTPDPYVELFIPTAPESRKRTK
HIDNDINPKWNETFHFILDPNLQNTLEITLMDANYVMDETLGTSSFDISKLTVGQTQTES
FLIGKTTKVHLEMSLEICTKLDLRFSLALCDKEKEFRRNRRDRVMLGIKKLLDMEKLCFQ
LRSPEEVPVIAVAGSGGGFRAMVAFSGVMKALFESGVLDCVTYVAGLSGSTWYMSTLYSH
PDFPNKGPKDINKELMKRVSSNPLRLLLPQHITNYIQALWTKKARGQPVTFTDIFGMLIG
ETLIPARMDTKLSEIQDKIDQAQSPLPLFTCLHVKPDVSELMFADWVEFSPYEIGMAKYG
TFMTPDLFGSKFFMGTAVRKYEENPLHFLMGVWGSAFSILFNRVLGVKDMGGGSTMEEEL
EQIKPQHIVGDDSLDNDDDPRKGGRENQEAEDDNRKAQASWVERMFTSLFSDSSLFNTRE
GRAGKVHNFMLGLNLNTSMLFSPLHEVTYHAPTPEEEVDAVTDPDEFDRIYEPLDVKSKK
IHVVDSGLTYNLPYPLILRPQRTVDLIISFDFSARPSDSSPPFKELLLAEKWARMNKLPF
PKIDPKVFDREGLKECYIFKPKKGEKNCPTVIHFVLVNINFRKFKAPGVPRETEKEKDLA
DFDIFDDPESPFSTFNFQYSNEAYTRLHDLMEFNTLNNLEVIKDSIKDCILSRKENPSCS
PVPFSLSEIPKKKFLRRDQHSKAWNHLGMDKK
NT seq 2259 nt NT seq  +upstreamnt  +downstreamnt
atgatgactgacgtaatggatttattgcaggtggaacagcagttctcacacaagttcaca
gtgaatgtggtcagtgctgagaacgttaccaagggggcgctaggcgatttattggatacc
cccgatccatatgtggagctgttcatcccaacagccccagagagcagaaagcgaaccaaa
cacatcgacaacgacatcaatccaaaatggaacgagacgtttcacttcatcttagatccc
aacctgcaaaacacactggagatcacattaatggacgccaattatgtgatggacgagaca
cttggaacgtcgtcttttgacattagtaagctcacagtgggacaaactcagacggagtct
ttcctcatcggcaaaacgaccaaagtacacttggagatgtcactggagatttgcaccaaa
ctggacctgaggttcagcctggccctgtgtgacaaagagaaggagttcagacgaaaccgc
agagacagagtcatgctgggcatcaagaagctgctggacatggagaaactctgcttccag
ctcaggtctccggaagaggtaccagtgatagctgttgccggctcaggcggtggtttccga
gccatggtggccttctcaggcgtcatgaaggccctgtttgagtccggggttctggactgt
gtcacatacgtcgctggactctctggttctacatggtatatgtccactctctactcccac
ccggactttccaaataagggaccaaaggacatcaacaaggagctgatgaagagggtgagc
agtaaccctctgaggctgctgctgccccaacacatcaccaactacatccaggctctgtgg
accaaaaaggccagaggccagcctgttaccttcactgacatcttcggtatgctcatagga
gagacactgatacctgcgaggatggacaccaaactcagtgagatccaggacaaaatagat
caggctcagagtcctcttcctctcttcacatgtctgcacgtgaagcccgatgtttctgag
ctcatgtttgcagactgggtggagttcagcccatatgaaatcgggatggcaaagtacgga
acgttcatgaccccggacctgtttgggagcaagttcttcatgggaactgctgtcaggaaa
tatgaggaaaaccctcttcattttctcatgggtgtttggggaagtgccttctctatcctg
ttcaacagagtgctgggagtcaaagacatgggcgggggcagcaccatggaggaggagtta
gagcaaatcaaacctcagcacattgtcggagatgacagtctggacaatgatgatgatcca
cgaaaaggtggaagagagaaccaggaagcagaggacgataatcgcaaggctcaggccagc
tgggttgagagaatgttcacctcactcttcagcgattcttctctgttcaacaccagggag
ggtcgtgccgggaaggttcataatttcatgctgggcctgaatcttaacaccagcatgctt
ttctctccgctgcacgaggtcacgtatcacgctcccacacccgaggaagaggtggacgca
gtcacagacccggatgagtttgatcgcatctatgagcctctggacgtgaagagtaagaag
atccatgtggtggacagtggcctgacctataacctcccctaccctctcatcctgcgcccc
cagcgcacggttgacctgattatctcgtttgacttttctgccagacccagtgattccagc
cctccattcaaggagctactgttggccgaaaagtgggctcgaatgaacaagcttccattc
cccaagattgaccccaaagtctttgatcgtgagggcctgaaggaatgttacatcttcaaa
ccaaagaaaggagagaagaactgtcccaccgtcatccactttgtcctggtcaacatcaac
ttcaggaaattcaaagcccctggtgtgcccagagaaacggagaaggaaaaagatttggca
gatttcgacatctttgatgaccctgaatcaccgttctcaacgtttaatttccagtactct
aacgaagcttacacccgcctccatgatctcatggagttcaacacgcttaacaaccttgag
gtcattaaagattccatcaaggactgcatcctctctcggaaggagaacccttcatgtagc
cctgtgccattctctctgagtgagatcccgaaaaagaaatttctcagaagagatcaacac
tcaaaagcctggaatcacttgggaatggataaaaagtaa

DBGET integrated database retrieval system