KEGG   Cynoglossus semilaevis (tongue sole): 103396384Help
Entry
103396384         CDS       T04866                                 

Definition
(RefSeq) 5-beta-cholestane-3-alpha,7-alpha-diol 12-alpha-hydroxylase
  KO
K07431  sterol 12-alpha-hydroxylase [EC:1.14.18.8 1.14.14.139]
Organism
csem  Cynoglossus semilaevis (tongue sole)
Pathway
csem00120  Primary bile acid biosynthesis
csem01100  Metabolic pathways
csem03320  PPAR signaling pathway
Brite
KEGG Orthology (KO) [BR:csem00001]
 09100 Metabolism
  09103 Lipid metabolism
   00120 Primary bile acid biosynthesis
    103396384
 09150 Organismal Systems
  09152 Endocrine system
   03320 PPAR signaling pathway
    103396384
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   00199 Cytochrome P450 [BR:csem00199]
    103396384
Enzymes [BR:csem01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.14  With reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.14.139  5beta-cholestane-3alpha,7alpha-diol 12alpha-hydroxylase
     103396384
   1.14.18  With another compound as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.18.8  7alpha-hydroxycholest-4-en-3-one 12alpha-hydroxylase
     103396384
Cytochrome P450 [BR:csem00199]
 Cytochrome P450, animal type
  CYP8 family
   103396384
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: p450
Motif
Other DBs
NCBI-GeneID: 103396384
NCBI-ProteinID: XP_008332661
Position
20
AA seq 511 aa AA seqDB search
MGLLLPILACILASVIGGLYLLGVFRRRLPGEPPLDKGIIPWLGHVLEFRRDTLKFIERM
QKKHGDVFTIQLGGFYITFLQDPLSFGAFVKESREKLDFSKFAKALVRKVFGYVAEEEEH
HLLQVTSNKHLKGDGLKLMTEAMMDNLQTLMLHRVGSVSDQNPWIEDGLFMYSYNILFRG
GYLSLYGNTPAESEESEEKAKEKDRAESQALFCEFRKYDQLFPNLAYGVVTPTERIEAKR
LMGKFWNALSVQKMMAKNNISGWIRDMQQARHEWGMNTSMIDRYMFVLLWASQGNTGPSS
FWLLLYLMKHPEALEAVKEEVDRVVKESGQEIRRGGPLINLTHEMLLRTPVLDSALDESL
RLTAAPLLTRAVLEDMTLKMADGREYFIRKGDRMAMFPYSAVHIDPEIHPDPHSFKYDRF
LNPDGSKKTDFYKQGKKVRYYNMPWGAGVSMCPGRFFASNEMKQFVFLMLAYFEFELKNP
DENIPEIDYRRWGFGSMQPVKDVQFRYRLRF
NT seq 1536 nt NT seq  +upstreamnt  +downstreamnt
atgggactgttgcttcctatccttgcttgcattctggcctctgtgattggaggactgtac
cttcttggagtgtttcgacggcgcctaccaggagaaccccctttggataaggggatcatt
ccttggctgggtcatgtcttggagtttcgcagggacacactgaaattcatagagaggatg
cagaaaaagcatggtgatgtgtttacaatacagctgggtgggttttacattacattcctt
caggatccgctgtcatttggagcatttgttaaggagagcagagaaaaactagacttcagc
aagtttgccaaggctcttgtacgtaaggtgtttggttatgtggcagaagaggaagagcat
caccttctccaggttaccagcaacaagcatctgaaaggagacgggttaaagttaatgacg
gaggccatgatggacaatttacagaccctgatgctgcacagggtgggctcagtttcagac
caaaacccctggattgaagacgggctgtttatgtacagctacaatattctgttcagaggt
ggctacttgtctctgtatggcaacaccccggctgagtcggaagaaagtgaagagaaagcc
aaagagaaagacagggctgagtctcaagcgttgttctgtgagtttcgtaaatatgaccaa
ctcttccctaacttggcttatggcgtggtcacaccaacagaaaggatagaagcaaagaga
ctgatgggaaagttttggaacgctctgtcagtgcagaagatgatggccaagaacaacatc
agcggttggatacgggacatgcagcaggctaggcacgagtggggtatgaacacttcaatg
atcgacaggtacatgtttgtgcttctttgggcatctcagggcaacacaggaccctcctca
ttttggctgctcctctaccttatgaaacacccagaagccctggaagcagtgaaagaagaa
gtggacagggttgtgaaggaatctggacaagaaatacgtcgcggcggccctctgatcaac
ctgacccatgaaatgttgctgagaaccccggtacttgacagcgctctggatgagtcccta
agactcactgccgcacccctcctcaccagagctgtcctggaggacatgaccctcaaaatg
gcagacggacgcgagtacttcattcgcaaaggtgacagaatggcaatgtttccttacagt
gcggttcacattgacccagagatccaccctgacccgcattctttcaaatacgaccgcttc
ctcaatccagatgggagcaagaaaacagatttctacaagcaggggaagaaagtgagatat
tacaacatgccctggggagctggggtttccatgtgtccaggtcgattcttcgccagcaac
gagatgaagcaatttgttttcttgatgttggcctattttgagtttgagctgaagaaccct
gatgaaaatatcccagaaattgattacaggcgctggggctttggttccatgcagccagtc
aaagatgttcagtttagatacagacttaggttttaa

DBGET integrated database retrieval system