KEGG   Cynoglossus semilaevis (tongue sole): 103397926
Entry
103397926         CDS       T04866                                 

Definition
(RefSeq) endoplasmic reticulum aminopeptidase 1
  KO
K09604  adipocyte-derived leucine aminopeptidase [EC:3.4.11.-]
Organism
csem  Cynoglossus semilaevis (tongue sole)
Brite
KEGG Orthology (KO) [BR:csem00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:csem01002]
    103397926
Enzymes [BR:csem01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.11  Aminopeptidases
    3.4.11.-  
     103397926
Peptidases and inhibitors [BR:csem01002]
 Metallo peptidases
  Family M1
   103397926
SSDB
Motif
Pfam: Peptidase_M1 ERAP1_C Peptidase_M1_N
Other DBs
NCBI-GeneID: 103397926
NCBI-ProteinID: XP_008334586
UniProt: A0A3P8VH78
Position
Z
AA seq 952 aa
MRGGEVLCLNMLVAPVLLLLFSSFHTVSAAQLPNQNQIKDPPIATNGQPFPWDRMRLPKT
VSPVHYDLRIHPNLTSLNFSGSVFISLDIHEDTSSIILHAKKMQISNVRLLAPEGIRPLR
MLEYPGFHQLALLSDSPLTKGQKYVVQLDFAANLSDSFRGFYKGSYRTSSGEVRVLASTQ
FEATFARGAFPCFDEPAFKANFTVRIIREPRHIAISNMPKIKTVELSEGLLEDYFDTTVK
MSTYLLAYIVCDFLSVSRTTNRGVKISAYAVPEKINQTAFALDAAVKLLDFYEDYFDIPY
PLPKQDLAAIPDFQSGAMENWGLTTYREAGLLFDPEKSSASDKLGIVKVIAHELAHQWFG
NLVTMEWWNDLWLNEGFAKFMEFISVDVTYPELHVEDLFLGKCFEAMEVDSLSSSHPVST
PVENPVQIQEMFDDVSYDKGACILHMLRDFLTPEVFEIGIIKYLKRYSYKNTVNGHLWES
LTDVCGLEDVAVGQKKHRDFCSNRKRSTEESKWFSGEELDVKAIMDTWTLQEGFPLVTVE
VRGREVRLSQERYLKSDDPSLTDGFLWQIPLTYITSASSTVQRFLLKSKTDVLHLPEEVD
WVKFNVDMTGYYMVHYAIRNGWSSINRLLKHNHTALTGNDRASLIHNVFQLVSIGKVSLD
TALELSLYLSKETEIMAVIQGFGELVPLYKLMEKRDMAALENQMKGYILDLFQGLIDRQE
WTDSGSVSERMLRSYLLLFACVRNYSPCLTKATQLFNMWKDSDGTMSLPVDITMAVFLVG
ARSPEGWDFLFEKYRTSIQTSVKSRMKMAMAATPLQDKLKLMMEQSLHGEVMKTQDLPYV
VVSVSNNPHGYKLAWDFLRANWEVMIKKFDLGSHSITHMVTGVTSRYSTREMLEEVRSFF
GSLTEESGSDMRCIQQAYESIEDNIRWMDANLPLLQAWLDKRSRRSVVHEDL
NT seq 2859 nt   +upstreamnt  +downstreamnt
atgagaggaggtgaagtactttgtctcaacatgttagtggctcctgtcctgctgctcctc
ttctcttccttccacactgtatctgcggcacagctgccaaaccagaaccagataaaggac
cctcccatcgccaccaatggtcaacccttcccgtgggatcgcatgcgactccccaaaact
gtctctccggtccactatgacctcaggattcaccccaacctgacctctctgaacttctcc
ggatccgtcttcattagcctggacatacacgaggacacgagtagcatcattctccatgct
aaaaagatgcagatctcaaatgtgcgactcctggcacctgagggcatcaggcctctgcgc
atgctggagtatcctggtttccatcagctcgccctgctgtctgattcccccttgacaaaa
ggacaaaagtatgtagtccagttggactttgctgcaaatctgtccgacagcttccgtggt
ttctacaagggcagctaccgcaccagcagtggagaagtccgggtcctggcatcgacgcag
tttgaagccacgtttgctcgtggagcctttccctgttttgacgaaccagcttttaaagcc
aacttcaccgtacgaatcatacgtgagccgcggcacattgcgatatccaacatgcccaag
attaaaacggtggagttgtcagaaggtttgctggaggattattttgacaccacagtgaag
atgagcacatacctgctggcctacatagtctgtgatttcctgtctgtgagcaggaccacc
aaccgtggtgtcaagatttcagcctatgctgtgcctgagaagatcaaccagacggccttt
gctctggatgctgctgtcaagctgttggacttctacgaagactactttgacattccttat
ccacttccaaaacaagatctggctgccattcctgacttccagtcaggggcgatggagaat
tgggggctgaccacttacagagaggcaggcctcttatttgaccctgaaaagtcatcagct
tcggacaagctcggcattgtcaaggtcatcgctcacgagctagcacaccagtggtttggg
aatctggtgacgatggagtggtggaacgacctgtggctcaatgagggttttgccaaattc
atggagtttatttctgtagacgtcacctacccagagctacatgtggaggacctcttcttg
gggaaatgttttgaggcgatggaggttgactccctcagctcttcccaccccgtctccacc
cctgtggagaacccggtccagatccaggagatgtttgatgacgtctcctacgacaaggga
gcttgtatcctccacatgctgagagactttctgacaccagaggtgtttgagatcggcatc
atcaaatacctcaaacgctacagctacaaaaacacagtcaacggccacctgtgggagagc
ctgactgatgtctgcggcttggaagacgtggccgtgggtcaaaagaaacacagggatttc
tgctccaatcgtaaacgttcaactgaagaatctaaatggttctctggtgaggagctggac
gtcaaagccatcatggacacctggaccctgcaggagggcttcccactggtcactgtcgag
gttagagggcgggaggtcaggctaagtcaggaacgttatctcaaatcagacgacccgtcc
ctcactgatggatttttgtggcagattccattgacctacataaccagcgcatccagcaca
gtccaaagattcctacttaaatcaaagactgatgtcctgcacctgccagaggaggtggac
tgggtgaagtttaacgtagacatgaccggttactacatggtccactacgcaatacgcaat
gggtggagctctatcaacagactgctgaagcacaaccacacggcgctgaccggcaacgac
cgcgccagcctcatccacaacgtgttccagctggtcagtatcgggaaggtgagtctggac
acggctctggagctgtccctctatctctcgaaggagactgagatcatggcagtgatccag
ggcttcggagagttggtgcctctctacaaactgatggagaagagagacatggcagccctg
gagaaccagatgaagggctacatattggacctgttccagggtctgattgatcgccaggag
tggactgactcagggtcagtgtctgagaggatgctcaggagctacctgctgctgttcgcc
tgtgtcaggaactactccccctgtctgaccaaagccacacagctctttaacatgtggaag
gactccgacggcaccatgagtcttccggtcgacatcacaatggctgtgtttttggtcgga
gctcgatcaccagaggggtgggacttcctgtttgagaagtatcgcacctcaattcaaaca
tccgtcaagagccgaatgaagatggccatggctgccactccgctgcaggacaagctcaaa
ttgatgatggagcagagcctccacggtgaagtgatgaaaactcaggatctcccatacgtg
gtcgtctccgtcagcaataacccacatggctacaagctggcgtgggattttctacgagcc
aactgggaggttatgatcaagaagtttgacctgggctctcactctataacccacatggtg
accggggtgaccagccggtattctaccagagagatgttagaggaggtacgaagtttcttc
ggctctttgaccgaggagtccggctcagatatgcgatgcatccaacaggcgtacgagagc
atcgaggacaacatccgctggatggacgccaacctacctctgttgcaggcctggctggac
aaacgcagcagacgcagtgtggttcacgaggatttataa

DBGET integrated database retrieval system