KEGG   Cynoglossus semilaevis (tongue sole): 103398401Help
Entry
103398401         CDS       T04866                                 

Definition
(RefSeq) aldehyde dehydrogenase family 9 member A1
  KO
K00149  aldehyde dehydrogenase family 9 member A1 [EC:1.2.1.47 1.2.1.3]
Organism
csem  Cynoglossus semilaevis (tongue sole)
Pathway
csem00010  Glycolysis / Gluconeogenesis
csem00053  Ascorbate and aldarate metabolism
csem00071  Fatty acid degradation
csem00280  Valine, leucine and isoleucine degradation
csem00310  Lysine degradation
csem00330  Arginine and proline metabolism
csem00340  Histidine metabolism
csem00380  Tryptophan metabolism
csem00410  beta-Alanine metabolism
csem00561  Glycerolipid metabolism
csem00620  Pyruvate metabolism
csem01100  Metabolic pathways
Module
csem_M00135  GABA biosynthesis, eukaryotes, putrescine => GABA
Brite
KEGG Orthology (KO) [BR:csem00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    103398401
   00053 Ascorbate and aldarate metabolism
    103398401
   00620 Pyruvate metabolism
    103398401
  09103 Lipid metabolism
   00071 Fatty acid degradation
    103398401
   00561 Glycerolipid metabolism
    103398401
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    103398401
   00310 Lysine degradation
    103398401
   00330 Arginine and proline metabolism
    103398401
   00340 Histidine metabolism
    103398401
   00380 Tryptophan metabolism
    103398401
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    103398401
Enzymes [BR:csem01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.3  aldehyde dehydrogenase (NAD+)
     103398401
    1.2.1.47  4-trimethylammoniobutyraldehyde dehydrogenase
     103398401
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Aldedh
Motif
Other DBs
NCBI-GeneID: 103398401
NCBI-ProteinID: XP_008335228
UniProt: A0A3P8UBF8
Position
2
AA seq 505 aa AA seqDB search
MAQSILDLIPETCTGTLTITEHLNFWGGKRVKPLHETNVEPVFEPATGHVLCQMVPCGAE
EVDEAIKSAYGAYKKWSKLAGTERARVMLEAARIIRERREKIAKLEVINNGKSITEALVD
IDIAWESIEYYAGLASTLSGQHVQLPGGAFAYTRREPLGVCVGIGAWNYPFQIASWKAAP
ALACGNAMVFKPSPMTPVTAVILAEIFKEAGAPDGLFCVVQGGAETGSLLCHHPMVAKVS
FTGSVPTGKKVMEMSSKGVKQVTLELGGKSPLIIFKDCELENAVKGALMANFLTQGQVCC
NGTRVYVQREIMPQFLDEVVKRTKAIRLGDPMLDDTNMGALISKPHLEKVLGFVDQAKKQ
GAKVLCGGEPFTPTDPKLKGGYFMSPCVLDNCRDDMTCVKEEIFGPVMSVMPFDTEEEVL
QRANNTTFGLASGVFTRDISRAHRVAANLEAGTCFINNYNISPVQVPFGGYKMSGFGREN
GEVTIEYYSQLKTVVVEMGDVESLF
NT seq 1518 nt NT seq  +upstreamnt  +downstreamnt
atggctcagtcaatcctcgaccttattcctgagacatgcacgggaacccttaccataact
gaacatctgaacttctggggagggaaacgggtgaagccccttcatgagaccaacgttgaa
ccggtttttgagcctgctactggccatgttctgtgtcagatggtcccctgtggggctgag
gaagttgacgaggccataaagagtgcctatggtgcctacaaaaaatggagcaagttggca
ggaaccgagagagccagagtgatgctggaggctgctcggattatcagggaaagaagggag
aagatcgcaaagttggaagtaattaacaatggcaagtcaatcactgaagccctggtggac
attgatattgcatgggaatccattgaatactatgctggtctggctagtacactctcaggc
cagcacgttcagcttcctggaggagcatttgcatacacaaggagggaacctcttggtgtg
tgtgtgggaattggtgcctggaattaccctttccagattgcatcatggaaggcagcacct
gctctggcatgtggtaatgccatggtcttcaaaccctctccaatgactcctgtgacagct
gttatcctggctgagatcttcaaagaggcaggagcaccagacgggctcttctgtgtggta
caaggtggagcagagacagggtcgttgctctgccaccacccaatggttgccaaagtttcc
tttacaggcagtgtgcccacaggcaaaaaggtcatggaaatgtcttcaaagggagtgaag
caggtgactttggaacttggagggaaatctccactcattattttcaaggattgtgaactt
gagaatgcagtgaagggtgcactcatggctaatttcctcacccaaggacaggtttgctgc
aatggtaccagagtttatgtacaacgagaaatcatgcctcagttcttggatgaagtggtg
aagaggaccaaggccattcgtttaggagaccctatgctggacgataccaacatgggtgct
ttgatcagcaaacctcacttggagaaggtgcttggatttgtggatcaggccaaaaagcag
ggagccaaggtgctttgtggaggagagccttttactcctacagaccccaaactcaaaggt
ggctacttcatgtccccttgtgtgcttgacaactgtagagatgacatgacctgtgtgaag
gaggagatctttgggcccgtcatgtcagtcatgcctttcgatacagaggaggaggttctc
caaagagccaacaacaccacgtttggactggcttccggagtcttcaccagggacatttcc
agagcccatcgtgtagcagcaaacctggaggcagggacctgcttcatcaacaattacaac
atcagtcctgtgcaagtgccatttggaggatacaagatgtcagggttcggcagagaaaat
ggtgaggtaaccattgagtactactcccagttgaagactgtggtggtggaaatgggagat
gtggagagcctcttttaa

DBGET integrated database retrieval system