KEGG   Cynoglossus semilaevis (tongue sole): 103398565Help
Entry
103398565         CDS       T04866                                 

Gene name
dock8
Definition
(RefSeq) dedicator of cytokinesis protein 8 isoform X1
  KO
K21852  dedicator of cytokinesis protein 6/7/8
Organism
csem  Cynoglossus semilaevis (tongue sole)
Brite
KEGG Orthology (KO) [BR:csem00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:csem04131]
    103398565 (dock8)
Membrane trafficking [BR:csem04131]
 Others
  Rho GTPase associated proteins
   Rho guanine nucleotide exchange factors (GEFs)
    103398565 (dock8)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DHR-2 DOCK-C2 DUF3398 DOCK_N
Motif
Other DBs
NCBI-GeneID: 103398565
NCBI-ProteinID: XP_008335447
Position
Unknown
AA seq 2092 aa AA seqDB search
MASLGSAERRAFALKLNRHSSAEIRRQYGNYGVYHSRSNSNASASTCITVPQSYDAVEPL
DLEEFLMSQLQSGDLALMQELGDFPDDELKVEQVDKDCRTVRFSVPEEGVELEPHVRDCV
KSYIQPWLVVSRRCQGNGWSVYSERAGLHKLLLKQTFESDFQPQNQQKTVKSPTLAVLND
DSGRTLTSSDFNLRCLNPDQRVGGLLAFSSHEELDHFNQEARLGNRHLELFALYPPADEE
EAVEIRPIPDCPKEHTGDRILIRCQAIKFEIDIEPIFATMALYDLKEKKKISENFYCDLN
SEQFRNFLKPQTPHVDQSTLARSAIFSVTYPSPDIYLVIKIEKVLQQGEIGDCADPYMTL
RECESAKNKDKLEKLRGQAEAFCHRLGRYRMPFAWATVNVMEVISTAAIERDFTDSDSIR
VKSSSIDRKAQLPRRNSERFSTLDDQFCNISSFKPATITISTIFKQEGDRLSDEDLLKFL
ADIKKNSTPQRRIKTIPGCIKLDMSPVQDTPLGCLSTELIPLIPPAEKTIRPVKEVLEFP
SSEVYVPHSIYRNMLFIYPQRLNFVNRLTSARNITIKIQFMRGEDPSCSQKVIFGKSSGA
EFLTEVYTPVTYHNKSPDFYEEVKIALPAFLTERHHLLFTFYHISCQQKQNQSGNCETLI
GYSWLPILNNDRLQTGQFCLPIVLERLPMNYSLHTPEKLPPQVPPVKWMESHKGLFNLEI
QAVSSVHTQDNHLERFFTLCHALEGGATFPLRVREEKIPENKLEHELKLSIVSLSSSNLE
PLVLFLHLVLDKLFTLIMQPMVIAGQTANLAQIAFESVVSIVNSLHISQELIRDQQGRNS
LLATYLYWVFSLPDPPRDMPHINSTSVINSTESRYSTIGRATATTVGNMLLQSRIRSSSN
PDIPGPHSSAEDAEVKNILSAKGLNHPGCRMSTYLDVNNHQIPSGNTRPSNRKQFHEELA
LQMVVSAGVCRENVYKYAWFFFELLVKSMAQHVSQLDRHSVPRRNRFSDRFKDDITTIVL
VVTAEIGTILVKQQKEVEQAEKVNISLAFFLYDLLSLMDRGFVFQLVKNYCNQMSAKNIP
MPTLISMRLEFLRILCSHEHYLNLSLFFSSQSFATASPCPSISSQGSGSCSFQEQQTILG
LFELSQDFKHQHYLTGLLLTELSAALDMESEGGKVQRKAINAIYSLLCSHDLDHRCIKPE
VRAKVATLYLPLVGIVIDSTNYLDFTVSDTRGGKNKTAIPDDDLENVPPINQSVALAIAG
NPFNTLGRNVLVSMVSMQGKSVATLAADTSRHLLVCFLWVMKNADKNLIQRWTIEMPPSQ
LNKLLELLTICVSCFEYRGKQCSDKVSTQALQKSQQAKLQLEEALLRGMGARGEMMKRVG
GMDRTPGQRENLRWRKDLTQWRQTNDKQDKTKAELDQEALISGNLATETNLIVLDLLETI
VQAVPLAECKDSVVGGVLKVLLHSLTCNQSTLFLSHTFSTLRALVVKFGDLLFEEEAEQC
ADLCQKVLQYCSSHVDKNRSQACATLYLIMRYSYSNASNFSRVKMQVTMSLASLVGKSSD
FQEEYLRRSLRTILAYAEEDTEMQNTQLPSQVDELLRNLNSILSDTVKMREFQEDPEMLM
DLMYRIAKGYQTSPDLRLTWLQNMAEKHINRKCYTESAMCLIHAAALVAEYLSMLEDHKY
LPVGSVTFQNISPNVLEESAVSDDILSPDEDGVCSGRYFTESGLVGLLEQAAELFSNGGL
YEAVNDVYKIIIPILEAHRDFRKLASTHDKLQKAFDTVIQKGHKRMFGTYFRVGFYGAQF
GDLDEREFIYKEPGITHLPEISHRLENFYSQCIGDDTLVMIKDSTPVDRKQLNPNKAYIQ
ITYVEPYFDDYEMKDRLTNFEKNFNLRRFMYTTPFTKSGRPRGELQEQYKRKTILTTMHA
FPYVKTRINVIQKEEFDLTPIEVAIEDMQKKTRELAVATHREQPDAKMLQMLLQGSVGTT
VNQGPLEVAQVFLNEIPADPKLFRHHNKLRLCFKEFIMRCGEAVEKNKHLITLDQKEYQL
ELKKNYNRLRESLRPMLERKIPELYKPIIRPQLQNRDSFKRLSFRRAQEDNS
NT seq 6279 nt NT seq  +upstreamnt  +downstreamnt
atggcttccctgggcagcgcagagagacgggctttcgccctcaaactcaacaggcactcc
tctgcagagatcagacgtcagtatggaaactatggcgtctatcacagcagatccaactcc
aacgcttcagcctcaacttgcatcactgtgccccagtcgtatgacgcagtggagcccctt
gacctcgaggagtttttgatgtctcaactacaaagtggagacttggctctgatgcaagag
ctgggagactttcctgacgatgaactcaaagtagagcaggtggacaaggattgccgcact
gtgaggttctctgttcctgaggaaggagtggagctggagcctcatgtcagagactgtgta
aagagctacatccagccctggctcgtggtctctcggaggtgccagggcaatggatggagt
gtctattcagagcgtgctggactacacaaactgctactgaaacagacctttgagtcagat
ttccagccgcaaaaccagcagaaaacagtcaagtctcccactctggctgtgctgaatgat
gactctggccgcacactgacatcctctgattttaatcttcggtgtttaaatccagaccag
agagtgggggggctgctggcgtttagcagccatgaggagttggaccattttaaccaagag
gctcggctgggaaatcgacacctggagctgtttgctctttacccacctgctgatgaggaa
gaagcggtggagatccgtcccattcctgactgtcccaaagaacacactggagaccgcatc
ctcatccgatgccaggccatcaagtttgagatcgacattgagcccatttttgcgacaatg
gctttgtatgaccttaaagagaaaaaaaagatatcagaaaacttttactgtgatctgaac
tcggagcagtttagaaatttcttgaaacctcaaacgccccacgtagatcagtccactttg
gccagatctgccatcttctcagtcacctacccttctccagacatctacctggtaatcaag
attgagaaggttctacagcagggggagattggtgactgtgccgacccctacatgacctta
agggaatgtgaatcagcaaagaacaaggacaagcttgagaaactgcgtggtcaggcagag
gcattctgccacagactaggacgctatcgcatgccttttgcgtgggccactgtcaatgtc
atggaggtcatctccaccgccgccatcgaacgtgacttcacagactccgatagcataaga
gtaaaatccagcagcatcgatcggaaagcacagcttcccagaagaaactccgaacgcttc
agcactcttgatgatcagttttgtaacatctcttccttcaaacctgccaccatcactatc
agcaccatcttcaaacaggagggtgaccgtttgagtgatgaggacttgctcaagttcctg
gctgacatcaagaaaaactccactccacagagaagaatcaagacaataccaggatgcatc
aaactggacatgtctccagtccaggacacaccacttggttgtttgtccactgagctaata
ccactcattccaccagctgagaagacaattcgtccagtcaaggaggtcctggagtttccc
tccagtgaggtttatgtcccccatagcatttacaggaacatgctcttcatctacccccag
aggctcaactttgtcaacagactgacgtcagccagaaacatcaccattaaaatccagttt
atgagaggagaggatcccagctgttctcagaaagtaatatttggaaaatcaagtggcgct
gagtttctgacggaagtctacactccggtgacctaccataacaaatcacctgacttttat
gaggaagtgaagattgcgctgccagcattcctgacagagaggcatcatttgctgttcacg
ttctaccacatcagctgccagcagaagcagaatcagagtggcaactgtgagactctcatt
ggttactcatggctgcccatccttaataatgaccgccttcagactggccagttctgtctg
cccatcgtcttggagcgactacccatgaactattctcttcacacacctgagaaacttcct
ccacaggttcctccagtcaaatggatggagagtcataaaggactttttaacctggagatt
caggctgtgtcatctgtgcacacacaggacaaccacctggaacggttcttcacgctctgc
catgccttagagggtggagcaacatttcctctgcgggtcagggaagaaaaaattccagag
aacaagctggagcatgagctgaagctcagcatcgtctccctgtcctcttctaatttagag
cctctggtcctcttcctccatctagtccttgataaactctttacccttatcatgcagccc
atggtcattgctggccaaactgccaacctggctcagatagcctttgaatctgtggtgtca
atcgtcaacagtcttcacatcagtcaggagctgatcagagatcagcaggggagaaacagc
ctattggccacctacctatactgggtgtttagtctgcctgatccccctcgagacatgcca
cacataaattcaacgagtgtaataaattcgacagagagtcgttacagcaccataggtcga
gccacggcaacaactgtaggaaatatgctcctgcagtcgagaattcgcagcagcagtaac
cctgacattcctggtcctcactcctctgctgaagatgctgaagttaaaaacatcctctct
gccaagggtctcaaccacccaggctgtcgtatgtctacctacctggatgtaaacaaccat
cagattccttcaggaaacaccagaccctcgaacagaaagcagtttcatgaggagctggcc
cttcagatggttgtcagtgcaggggtctgcagagagaacgtctacaaatatgcctggttc
ttctttgagctgttggtgaaaagcatggctcagcatgtgtctcagctggacaggcacagt
gtcccacgcagaaatcgcttctctgaccgattcaaagatgacatcaccaccatcgtgttg
gtggtcacagcggagatcgggactatccttgtcaaacaacagaaggaagtagagcaagca
gaaaaggtcaacattagccttgcctttttcctctatgaccttttgtctctgatggaccga
ggatttgtttttcagctggtaaaaaactactgcaaccagatgtcagcgaagaatattcca
atgccaactttgatcagcatgcgcctggagttcctgcgaatcctgtgcagccatgagcac
tacctcaacctgagccttttctttagcagccaatcctttgccacagcctcaccatgcccc
tccatatcttcacagggttctggatcctgtagtttccaggagcagcagaccatcctgggc
ctgtttgagctctctcaggatttcaaacaccagcattacttaacgggtctgctgctgacg
gagctcagtgctgctcttgacatggagtcagagggagggaaagttcagagaaaggccatc
aatgcaatttacagtctgctttgttctcatgatctggaccatcgatgtattaaacctgag
gttagagctaaagtggcaacactctacctccccctggtggggattgtaattgattccacc
aattatctggattttactgtatctgacacacgtggtggaaaaaacaagaccgccatacct
gacgatgaccttgaaaatgtcccacccatcaatcagtctgttgccttggcgattgctgga
aacccctttaacacactgggacggaatgtcctggtttccatggtatccatgcagggtaaa
tctgtagccacactggcagcagacaccagccgccacctgttggtgtgtttcctgtgggtc
atgaagaatgctgacaagaacctcattcagcgctggactatagaaatgcctccctcacag
ctcaacaagctgctggagctgctaaccatctgcgtgtcctgttttgaataccgggggaaa
cagtgcagtgataaagtgagcacccaggccctgcagaagtcccagcaggccaagctgcag
ctggaagaagccctgttgagaggcatgggagcgcgtggtgaaatgatgaaacgagtcgga
ggaatggacaggactccgggtcagagagagaacttgcgctggaggaaagacctgactcag
tggagacagaccaatgacaaacaggacaagactaaagcagagttggaccaggaggctttg
atcagcgggaacttagccacagagaccaacctcatagtgctggacctcctagagaccatt
gtgcaggcggtgccactggctgagtgtaaggacagcgtggtgggtggagtgctgaaggtg
ctgcttcactctcttacctgcaaccagagcacattgttcctctctcacaccttcagcaca
ctcagagcactggttgtcaagtttggagacttgctgtttgaggaagaagcggaacaatgt
gccgacctgtgtcagaaagttcttcagtactgcagcagccatgtggacaaaaacaggagt
caagcctgtgccacactttatctcatcatgagatacagctacagcaatgccagtaacttc
tcaagagtgaagatgcaggtcaccatgtctctggcctcactggtgggcaagtcctcagac
ttccaggaagaatacctccgtcgctccctacgtactatactggcttatgctgaggaggac
actgagatgcaaaacacacagctgccatcgcaagtggatgaactcctcagaaatttgaac
agtattctatcagacacagtgaaaatgagggaattccaggaagaccctgaaatgctgatg
gacctcatgtacaggatagcgaagggctatcagacatcccctgacctccgactgacctgg
ctgcagaacatggcagagaagcacatcaacaggaagtgctacactgagtcagccatgtgt
ctaatccacgctgccgccctggtggcggagtacctcagcatgctggaggaccacaagtac
ctgcctgtggggagtgtcaccttccagaacatctcccccaatgtgctggaggagtctgcc
gtgtcggatgacatcctgtccccagatgaggacggcgtgtgttcaggacgctacttcaca
gagagtggtctggtgggacttttggagcaggcggctgagcttttcagcaacggtggtctt
tacgaggcagtaaatgatgtctacaagatcatcatacctatcctggaggctcacagagat
ttcaggaaacttgcatcaactcacgacaaacttcaaaaagcctttgacaccgttattcag
aagggccataaaagaatgtttggaacctacttccgtgtgggtttttatggggctcagttt
ggtgacctggatgaacgagaattcatttacaaggagccgggcatcacacatctgcccgag
atttcacacagactggagaacttctacagtcagtgcatcggtgacgacacactggtgatg
atcaaggactcaacgccagtggacagaaaacaactcaaccctaataaggcttacatccaa
attacttacgtggagccctactttgacgactatgagatgaaagaccggctgacaaacttt
gagaagaatttcaacctgcggcgcttcatgtacaccacacccttcaccaaaagcggacgt
cctcggggtgaacttcaagagcaatacaagaggaagaccatcctcaccaccatgcacgcc
ttcccctatgtcaagactcgcattaacgtcatccaaaaggaggagtttgacctgactcct
attgaagtggccatagaagacatgcagaaaaagaccagagaacttgctgtggccacacac
agggaacagcctgatgctaagatgttgcagatgctgctgcaaggctcagtgggaaccact
gtcaaccagggcccattggaggtggcccaggtcttcctgaatgagatcccagcagaccct
aagctcttccgccaccacaataaactacgtctgtgtttcaaagagtttataatgaggtgt
ggtgaagcagttgagaaaaacaagcatctgatcacattggaccagaaggaataccagctg
gagctgaagaagaactacaaccgcctgagagagagcctgaggccaatgctggagaggaag
attcctgaactctacaaacccatcatcagacctcaactacagaatagggattcctttaaa
cgcctaagtttccgcagagctcaggaggacaattcctga

DBGET integrated database retrieval system