KEGG   Cynoglossus semilaevis (tongue sole): 103398651
Entry
103398651         CDS       T04866                                 

Definition
(RefSeq) deoxycytidine kinase-like
  KO
K00893  deoxycitidine kinase [EC:2.7.1.74]
Organism
csem  Cynoglossus semilaevis (tongue sole)
Pathway
csem00230  Purine metabolism
csem00240  Pyrimidine metabolism
csem01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:csem00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    103398651
   00240 Pyrimidine metabolism
    103398651
Enzymes [BR:csem01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.74  deoxycytidine kinase
     103398651
SSDB
Motif
Pfam: dNK AAA_18 AAA_33 AAA_17 Thymidylate_kin
Other DBs
NCBI-GeneID: 103398651
NCBI-ProteinID: XP_008335545
UniProt: A0A3P8W8P1
Position
Unknown
AA seq 323 aa
MAPLLNQVSNLTKQTGLAQVMRLCCSKPLQWNKPDSFLWPRNTTIVQTGNTKTSKGKKTY
QSIEGSRYLSSRASLLHGNVRVKRVSIEGNVAVGKSTLAEILQSACSDWEVMAEPVQKWQ
NIENETAKAEESSQNRVHNLLQMMYQDPQRWSYTFQTFSCMSRLRTQLQPAPARLLCSKG
TPVQVFERSVYSDRYIFALNMFELGCINSTEWAVYQDWHSFLVEQLGHQVELEGIIYLRA
SPETCMERLQHRGRSEEQGVKLDYLETLHLQHERWLIEKSTPIHFEKLQKIPVLYLDATV
KFQSDPEVQEQLVTKVKNFFEAL
NT seq 972 nt   +upstreamnt  +downstreamnt
atggcacctctgctcaaccaagtttcgaatttaactaaacaaactggtttagcacaggta
atgaggttatgctgcagtaagcctcttcagtggaacaaacctgacagctttctgtggcca
agaaacacaaccatagttcaaacagggaacactaagacaagtaaaggaaagaaaacatat
caaagtatcgaaggttcgaggtacctgtcgagcagagcttcacttctacatggaaatgta
cgagtaaaaagagtttcaatcgaaggcaacgttgctgttggaaagtcgaccttggctgaa
attttgcagtcagcgtgttcagactgggaggtaatggctgaaccagtccaaaagtggcag
aacatagagaatgaaacagcaaaggctgaagaatcgtctcagaacagagtccacaacctg
ctgcagatgatgtaccaggatcctcagcgttggtcgtacacatttcagaccttttcatgt
atgagtcgtttaagaactcagctgcagcctgctcctgctcgcctgctctgctcaaaggga
acacctgtccaggtgtttgaacgctcagtgtacagtgacaggtacatatttgccctcaac
atgttcgagcttggatgcatcaactccacagagtgggcagtctaccaggactggcactcc
tttctggtggagcagcttggacatcaggtggagctggagggtattatctacctcagagcc
tcaccagagacatgtatggagcgactgcagcatcgtggtcggtcagaagagcaaggagtg
aagctggattacctggagacacttcatcttcaacatgagcggtggcttattgagaagagt
acaccaatacattttgagaagttacaaaaaatacctgtgctgtatctcgacgccactgtg
aaattccagagtgaccctgaggtgcaggagcagcttgttacaaaggtgaagaactttttt
gaggctttgtaa

DBGET integrated database retrieval system