KEGG   Cynoglossus semilaevis (tongue sole): 103399070Help
Entry
103399070         CDS       T04866                                 

Gene name
cpt2
Definition
(RefSeq) carnitine O-palmitoyltransferase 2, mitochondrial
  KO
K08766  carnitine O-palmitoyltransferase 2 [EC:2.3.1.21]
Organism
csem  Cynoglossus semilaevis (tongue sole)
Pathway
csem00071  Fatty acid degradation
csem01212  Fatty acid metabolism
csem03320  PPAR signaling pathway
Brite
KEGG Orthology (KO) [BR:csem00001]
 09100 Metabolism
  09103 Lipid metabolism
   00071 Fatty acid degradation
    103399070 (cpt2)
 09150 Organismal Systems
  09152 Endocrine system
   03320 PPAR signaling pathway
    103399070 (cpt2)
Enzymes [BR:csem01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.21  carnitine O-palmitoyltransferase
     103399070 (cpt2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Carn_acyltransf
Motif
Other DBs
NCBI-GeneID: 103399070
NCBI-ProteinID: XP_008336040
Position
2
AA seq 654 aa AA seqDB search
MAALLHQTLFVSSVKRSGSSMCLRAAVLSSAIQRHRRLYSEYLHRSVVPTMHFQKSLPRL
PVPKLEVTMMRYLAAQRPLLDDEQYRTTEKLTQDFLVVQNKENKHTSYISAPWFNMYLSA
REPVVLNFNPFMSFNLDPKPDYNDQLIRATNMVCSAVRFMKTLRAGILEPEIFHLNPAKS
DTDSFKKLIRWVPSSLSWYGAFMVNAYPLDMSQYFRLFNSTRIPRQGQDELNTNEKGRHL
LVMRKGNMYVFDIVDGDGNLVSPAEIQSHLSYILSDQTPMPEFPIGVLTSENRDVWAGLR
EKLIATGNAENLHLVDSAIFCLCLDDEVMKDHIHISHNMLHGNGCNRWYDKSFSIIMAKD
GQAAINFEHSWGDGVAVLRFQNEIYKDTTQNPLVHPDSATAKVDSSSAVRRLQFNMDAKL
EDGIRKAKENFDAAVSKLTIDAMEFKKGGKNQLKKKKLSPDAVAQLAFQMGFMRQYGQTV
ATYESCSTAAFKHGRTETIRPASTFTKRCAHAFVNERGRQSVQELQAMIQDCSKYHGQLT
KEAAMGQGFDRHLFALRHLAQTKGQTLHQLYTDPAYAAINHNILSTSTLSSPAVNLGGFA
PVVPDGFGVGYGVHDDWIGCNVSSYPARNVHEFLQCVHQSLEDIFSVLEGKSLS
NT seq 1965 nt NT seq  +upstreamnt  +downstreamnt
atggcggctctgctgcaccagacccttttcgtttcttcagtaaaaagaagcggatcctcg
atgtgtttacgggccgcggttcttagtagcgctatccaaaggcatcgtcgactttacagc
gagtatttacaccgcagtgtggttcccaccatgcacttccagaagagtttacccaggtta
cctgtacctaaactggaggtcaccatgatgaggtatttggcagcacagcgccctctgctg
gacgatgagcagtacagaaccacagagaaactgacgcaggattttctggttgttcagaac
aaggagaacaaacacaccagctacatctcagctccctggttcaacatgtacctgtctgct
cgagagccagtggttctgaactttaaccctttcatgtcctttaatctggacccaaagccg
gactacaatgatcagctaatccgggccaccaacatggtttgttccgccgtgcgtttcatg
aagacgctgcgtgcaggaatccttgaaccagagatcttccacctaaacccggccaaaagt
gacacggactctttcaagaagttgatccgctgggttccgtcctcactgtcctggtacggg
gccttcatggtcaacgcttacccactcgatatgtcgcagtatttccgcctctttaactcc
acccgcattcccaggcaagggcaggatgaactcaacaccaatgagaaaggacgccacctg
ctggtcatgcgaaaaggaaacatgtatgtttttgacatagtagatggagacggtaatcta
gtctcgcctgcagagatccagtcgcacttaagctatattttgtccgatcagacgccgatg
ccagagtttccaatcggggttttgacgagtgagaacagggacgtgtgggcgggactcaga
gagaagcttatagccacaggaaacgctgaaaatttgcacctggtggacagcgccatcttc
tgcctgtgtctggatgacgaggtgatgaaagaccatatccacatctcccacaatatgctg
catggtaatggctgcaaccgctggtacgacaagtcgttcagcatcatcatggccaaggac
ggacaggccgccatcaactttgagcactcctggggagacggtgtggctgtactgcgattc
cagaacgagatttataaagataccacacaaaacccgctggttcacccagactctgccacc
gccaaagtggactcatcatctgccgtgcgtcgcctccagttcaacatggacgctaagctg
gaggatggcatcaggaaagccaaggagaactttgatgctgcggtgtccaagctcaccata
gatgctatggagtttaagaagggcgggaagaatcagctgaagaagaagaagctgagtcca
gacgccgtggctcagctggcattccagatgggcttcatgcgtcagtacggacagaccgtg
gccacctacgagtcttgcagcacggcggcgttcaagcacggtcgcacagagaccatcaga
cctgcgtccacattcaccaaacgctgcgcccacgcttttgtaaatgagagggggagacaa
agcgttcaggagcttcaggccatgatccaggactgctccaagtaccatggacagctcacc
aaggaggcagccatgggtcaaggatttgaccgacacctctttgctctcaggcacctggcc
caaacaaagggtcagactctgcaccagctctacactgacccagcctacgccgccatcaac
cacaacatcctgtccaccagcacgctcagcagtcctgcggtcaacctggggggctttgcc
cccgtggtacctgacggctttggcgttggctacggcgtccatgatgactggatcggctgt
aacgtgtccagttacccggctcgaaacgtccatgagttcctgcagtgcgtgcaccagtct
ttggaggacattttcagtgtcctggaggggaagtccctcagctga

DBGET integrated database retrieval system