KEGG   Cynoglossus semilaevis (tongue sole): 103399236Help
Entry
103399236         CDS       T04866                                 

Definition
(RefSeq) septin-7-like
  KO
K16944  septin 7
Organism
csem  Cynoglossus semilaevis (tongue sole)
Brite
KEGG Orthology (KO) [BR:csem00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:csem04131]
    103399236
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:csem04812]
    103399236
   04147 Exosome [BR:csem04147]
    103399236
Membrane trafficking [BR:csem04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Septins
    103399236
Cytoskeleton proteins [BR:csem04812]
 Eukaryotic cytoskeleton proteins
  Septins
   Septins
    Group 2
     103399236
Exosome [BR:csem04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   103399236
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Septin HEPPP_synt_1
Motif
Other DBs
NCBI-GeneID: 103399236
NCBI-ProteinID: XP_008336175
Position
Unknown
AA seq 102 aa AA seqDB search
MKRLHDKVNVIPLIAKADTLTPEECQLFKKQIMKEIQEHKIKIYEFPDTEDDEDNKLIRK
IKEKMPLAVVGSNVVIEVNGKKVRGRQYPWGVAEGWFSVVHL
NT seq 309 nt NT seq  +upstreamnt  +downstreamnt
atgaaaagactccatgacaaagtcaacgtcatccctctcattgcgaaagcagatactctg
actcctgaggagtgccagctgtttaaaaaacagattatgaaagaaatccaggaacacaaa
atcaaaatctatgagttcccagacacagaggacgacgaggacaacaagctcatccgaaag
ataaaggagaaaatgcccctggcagttgtcggaagcaacgtggtgatcgaggtgaatggg
aagaaggtcagaggtcgccagtatccgtggggcgtggcagaaggttggttctctgtggtt
cacttgtag

DBGET integrated database retrieval system