KEGG   Cynoglossus semilaevis (tongue sole): 103399449Help
Entry
103399449         CDS       T04866                                 

Definition
(RefSeq) carnitine O-palmitoyltransferase 1, liver isoform-like
Organism
csem  Cynoglossus semilaevis (tongue sole)
SSDB OrthologParalogGFIT
Motif
Pfam: Carn_acyltransf
Motif
Other DBs
NCBI-GeneID: 103399449
NCBI-ProteinID: XP_008336361
Position
Unknown
AA seq 163 aa AA seqDB search
TVQHWEDSDYIAIYHKGCYYCLKVYQAGRLLSPREIEFQIQRILDDPSPPCKGEAKLGAL
TAGNRISWATARHKYFGSGINRQSLHCIERAAFFVTLDDDNQGILKDNPAESLDRYAKSL
LHGKLYNRWFDKSFSVIYYKNGKNGINSEHSWADAPVVSHLWE
NT seq 491 nt NT seq  +upstreamnt  +downstreamnt
acactgtgcaacattgggaggacagcgactatatagcaatataccacaagggttgctact
attgcctgaaagtgtaccaggcaggccgtcttctttccccaagagaaattgaattccaaa
tccagaggatccttgacgatccatcacccccctgtaaaggagaagccaaacttggggccc
tcactgctggaaacagaatctcatgggctactgctaggcacaaatatttcggcagtggaa
taaacagacagtcgttgcattgcatcgagagagcagccttctttgtgaccctggatgatg
ataatcaaggcatattgaaagacaatcctgcggaaagtttggaccgctacgccaaatcct
tattgcatggcaaattgtacaataggtggttcgacaaatccttctcagtcatttactaca
agaatgggaagaacggcatcaactcggagcattcgtgggcagacgcgccagtggtttcac
acttatgggag

DBGET integrated database retrieval system