KEGG   Cynoglossus semilaevis (tongue sole): 107989622
Entry
107989622         CDS       T04866                                 

Gene name
apln
Definition
(RefSeq) apelin
  KO
K05225  apelin
Organism
csem  Cynoglossus semilaevis (tongue sole)
Pathway
csem04080  Neuroactive ligand-receptor interaction
csem04371  Apelin signaling pathway
Brite
KEGG Orthology (KO) [BR:csem00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    107989622 (apln)
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    107989622 (apln)
SSDB
Motif
Pfam: Apelin
Other DBs
NCBI-GeneID: 107989622
NCBI-ProteinID: XP_016894914
Position
15
AA seq 77 aa
MNVKILTLVIVLLVSLLRSAGAGPMASVEHGREVEEAPTVRKMVQQSPARGGQPHRPAGW
KRRRPRPRLSHKVPMPF
NT seq 234 nt   +upstreamnt  +downstreamnt
atgaatgtgaagatcctgacgctggtgattgtgctcttggtgtctctgctgcgttcggct
ggtgctggtcccatggcctccgtggagcatggcagagaagtagaagaagcccccacagtg
agaaaaatggtccagcagagtcctgcaaggggaggtcaacctcacagaccggccggctgg
aagaggagacgccctcggccccgtctgtctcacaaggtgcctatgccgttctag

DBGET integrated database retrieval system