KEGG   Comamonas serinivorans: CCO03_06730Help
Entry
CCO03_06730       CDS       T04892                                 

Definition
(GenBank) glutathione peroxidase
  KO
K00432  glutathione peroxidase [EC:1.11.1.9]
Organism
cser  Comamonas serinivorans
Pathway
cser00480  Glutathione metabolism
cser00590  Arachidonic acid metabolism
cser01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cser00001]
 09100 Metabolism
  09103 Lipid metabolism
   00590 Arachidonic acid metabolism
    CCO03_06730
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    CCO03_06730
Enzymes [BR:cser01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     CCO03_06730
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GSHPx AhpC-TSA Redoxin
Motif
Other DBs
NCBI-ProteinID: ARU04410
UniProt: A0A1Y0ELY3
Position
1579408..1579896
Genome map
AA seq 162 aa AA seqDB search
MTTAFDFDTRAIDGQTFSLSALRGHVLLIVNTASACGFTPQLQGLQQLWGRYGSQGLMVL
GFPCNQFGGQDPKPDGEIAQFCELNYGVDFPMMAKTEVNGDQAEPLFKWLKAQAPGVLGT
ESIKWNFTKFLVGRDGQVLRRYAPQDKPESLAADIEVALAKG
NT seq 489 nt NT seq  +upstreamnt  +downstreamnt
atgacgacggcattcgatttcgacacccgggccattgacggccagacgttctcgctctcg
gcgctgcgcggccacgtgctgctcatcgtcaacaccgccagcgcctgtggcttcacgccg
cagctgcagggcctgcagcagctgtggggccggtacggcagccagggcctcatggtgctg
ggctttccctgcaaccagtttggcgggcaggaccccaagccggacggcgagatcgcgcag
ttctgcgagctgaactacggggtggacttccccatgatggccaagaccgaggtcaatggc
gaccaggccgagccgctgttcaagtggctcaaggcgcaggcgcccggcgtgctgggcacc
gaatccatcaagtggaacttcaccaagttcctggttgggcgcgacggccaggtgctgcgc
cgttatgcgccgcaggacaagcccgaatcgctggcggccgacatcgaagtggcgctggcc
aaaggctga

DBGET integrated database retrieval system