KEGG   Comamonas serinivorans: CCO03_11570Help
Entry
CCO03_11570       CDS       T04892                                 

Definition
(GenBank) glutamate racemase
  KO
K01776  glutamate racemase [EC:5.1.1.3]
Organism
cser  Comamonas serinivorans
Pathway
cser00471  D-Glutamine and D-glutamate metabolism
cser01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cser00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00471 D-Glutamine and D-glutamate metabolism
    CCO03_11570
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:cser01011]
    CCO03_11570
Enzymes [BR:cser01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.3  glutamate racemase
     CCO03_11570
Peptidoglycan biosynthesis and degradation proteins [BR:cser01011]
 Precursor biosynthesis
  Racemase
   CCO03_11570
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Asp_Glu_race
Motif
Other DBs
NCBI-ProteinID: ARU06808
UniProt: A0A1Y0ETE9
Position
2741028..2741915
Genome map
AA seq 295 aa AA seqDB search
MSSTDLGSAPIGVFDSGIGGLSVLRALLQRLPQERFVYVADTGHAPYGEKSIAAITERSQ
RITHFLRDACACKALVIACNTATAVAAHTLRQAHAGWPIIGIEPAIKPAAALTRTGAVGV
LATQGTLSSPKYRELRSRVVASVNAADDAPALAVHDVACNGLASAIEALVDAANGPVAEQ
RVQALLHQYLGQLGHCGAEPGQVDTVVLGCTHYPLIADRIQALLPPQVTLLDPGDRVALH
TLNVLHALGQLSPRSAVSSAHQAVHLWTSGDPDRVSQAAQHWMHMAPLPAHPLPC
NT seq 888 nt NT seq  +upstreamnt  +downstreamnt
atgagttcaaccgacctgggctccgcgcccattggggtgtttgacagcggcatcggcggc
ctgagcgtgctgcgcgcgctgctgcagcgcctgcctcaggaacgctttgtgtacgtcgcc
gacaccggccacgcgccgtatggcgaaaagtccatcgccgccatcaccgagcgcagccag
cgcatcacccacttcctgcgcgatgcctgcgcgtgcaaggccctggtcatcgcctgcaac
acggccacggcggtggccgcccacacgctgcgccaagcccatgcgggctggcccatcatc
ggcatcgaacccgccatcaaacccgcagccgccctgacgcgcaccggcgccgtgggcgtg
ctggccacccagggcaccttgtccagccccaagtaccgcgagctgcgcagccgcgtcgtg
gccagcgtgaacgccgcagacgacgcccccgctctggccgtgcacgacgtggcctgcaac
ggcctggccagcgccatcgaagcgctggtggatgcagccaacggccccgtggccgagcag
cgcgtgcaagcgcttttgcaccaatacctgggtcagttgggccactgcggcgccgagccc
gggcaggtggacaccgtggtgctgggatgcacccactacccgctgattgccgaccgcatc
caggccctgttgccaccgcaggtcaccctgctggaccccggtgaccgtgtggccctgcac
accctgaacgtgctgcacgcgctggggcagctcagcccgcgctcggccgtttcatccgcc
caccaggccgttcacctgtggaccagcggcgatcctgaccgcgtgagccaggccgcccag
cactggatgcacatggccccgctgcctgcgcatccgctgccctgctga

DBGET integrated database retrieval system