KEGG   Comamonas serinivorans: CCO03_16435Help
Entry
CCO03_16435       CDS       T04892                                 

Gene name
putA
Definition
(GenBank) trifunctional transcriptional regulator/proline dehydrogenase/L-glutamate gamma-semialdehyde dehydrogenase
  KO
K13821  RHH-type transcriptional regulator, proline utilization regulon repressor / proline dehydrogenase / delta 1-pyrroline-5-carboxylate dehydrogenase [EC:1.5.5.2 1.2.1.88]
Organism
cser  Comamonas serinivorans
Pathway
cser00250  Alanine, aspartate and glutamate metabolism
cser00330  Arginine and proline metabolism
cser01100  Metabolic pathways
cser01110  Biosynthesis of secondary metabolites
cser01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:cser00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    CCO03_16435 (putA)
   00330 Arginine and proline metabolism
    CCO03_16435 (putA)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:cser03000]
    CCO03_16435 (putA)
Enzymes [BR:cser01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.88  L-glutamate gamma-semialdehyde dehydrogenase
     CCO03_16435 (putA)
  1.5  Acting on the CH-NH group of donors
   1.5.5  With a quinone or similar compound as acceptor
    1.5.5.2  proline dehydrogenase
     CCO03_16435 (putA)
Transcription factors [BR:cser03000]
 Prokaryotic Type
  Ribbon-helix-helix
   Other families
    CCO03_16435 (putA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh Pro_dh Pro_dh-DNA_bdg PRODH TPR_21
Motif
Other DBs
NCBI-ProteinID: ARU06042
UniProt: A0A1Y0ES15
Position
3858242..3862045
Genome map
AA seq 1267 aa AA seqDB search
MALFSLRPPPQTPRTHPHEGEALPPHTALRARITAHHRTPEPEAVAWLLPQVKAVADAET
TRRTLELATQIAQRLRERQARMGRTSLVQGLLQEYALSSQEGVALMCLAEALLRIPDPAT
RDALIRDKIAQGHWREHAGHSPSLFVNAATWGLLLTGKLVATHSETTLSSLLTRLIGQGG
EPLIRQGVQIAMRLMGEQFVMGETIADALRHARPLEAQGFRYSYDMLGEAAMTAEDADRY
RQAYEDAIHAIGKASNGRGVYEGPGISIKLSALHPRYSRAQRTRVMDELYPVVRRLALLA
RRHDIGLNIDAEEADRLELSLDLLERLCFEPALAHWHGIGFVIQAYQKRCPFVIDWCVDL
ARRSQHRLMIRLVKGAYWDSEIKRAQVDGLAGYPVYTRKAYTDLSYLACARQLLAAPEQV
YPQFATHNAHTLAAIYQLADPAAWQPGQYEFQCLHGMGEPLYEQVVGHTENGKLGRTCRI
YAPVGTHETLLAYLVRRLLENGANTSFVNRIADPTVPIAALVADPVAAVERLAQQGPPLG
APHPAIPLPAQLYGSARRNSDGLDLSNDDSLHALDEALTASAAVAWTAEPLLAQPAAEPA
AEGVPVVNPADASDVVGRVWPASAGQLQQALAAAHAFAPSWAATPVAERAAALERAADHL
QQRLPLLLGLLAREAGKTCANGVAEVREAIDFLRFYAAQARTSLATAAHTPLGPVVCISP
WNFPLAIFIGQIAAALAAGNPVLAKPAEQTPLVAAEGVRLLHAAGIPAAALQLLPGDGAT
VGAALVADARVQAVMFTGSTEVARQIQQTLAQRLGAGGAPVPLIAETGGQNAMIVDSSAL
VEQVVADVLGSAFDSAGQRCSALRVLCLQDEVADRVLHMLRGAMAELTVGNPARLSTDVG
PVIDAEARDTLEAHIAQMQRAGRQVQRLGRSAPDVPGRGTYVLPTLIEIEHIAELQREVF
GPVLHVVRFARPALGTLLAQIAATGYGLTQGLHTRIDETLREVAQHARVGNLYINRNLVG
AVVGVQPFGGQGLSGTGPKAGGPLVLHRLGAHGAGMALHQVVASALPGATPADAPADVPA
NVPAQAPAAHGALLAWLGGRHGLRLHQACLRLPQALGPHRAWLLAGPTGERNVYSWLPRE
AVLCLAEHDEALLLQLAAVLAVGSHAIWPLRADTRALRASLPHEVQAHITLSPDWTAPGV
RFDVALADGDAAGLRAAAQRLAAREGPIVSLWRCSMEAMPLEALLIERATSTNTAAAGGN
ASLMTIA
NT seq 3804 nt NT seq  +upstreamnt  +downstreamnt
atggcccttttctcgctccgcccgccgccccagactccccgtacccacccccacgagggc
gaggccctgcccccgcacacggcgctgcgcgcgcgcatcacggcgcaccaccgcacgccc
gagcccgaagccgtagcctggctgctgccccaggtgaaggcggttgccgacgccgagacg
acgcggcgcacgcttgaactcgccacgcagatcgcccagcgcctgcgcgagcgccaggcc
cgcatgggccggaccagcctcgtgcaaggcctgctgcaggagtacgcgctgtcgtcgcag
gaaggcgtggcgctgatgtgcctggccgaagcgctgctgcgcatccccgacccggccacg
cgcgatgcgctgatccgcgacaagatcgcgcagggccactggcgcgagcacgccggccac
agcccttcgctgttcgtcaacgccgccacctgggggctgctgctgaccggcaagctggtg
gccacgcacagcgagaccaccttgtcctcgctgctcacgcggctgatcggccagggcggc
gagccgctgatccgacagggcgttcagatcgccatgcgcctgatgggcgagcagttcgtg
atgggcgaaaccatcgccgacgccttgcggcatgcccgcccgttggaagcccagggcttt
cgctactcctacgacatgctgggcgaggccgcgatgacggccgaggacgccgaccgctac
cgtcaggcctacgaagacgcgatccacgccatcggcaaggcgtccaacggccgcggtgtc
tacgagggccccggcatctcgatcaagctgtcggcgctgcacccgcgctacagccgcgcg
caacgcacgcgcgtgatggacgagctctaccccgtggtgcgccgcctggcgctgctggcc
cggcgccacgacatcggcctgaacatcgacgccgaggaggccgaccggctcgagctatcg
ctggacctgctcgagcggctgtgcttcgagcccgcgctggcgcattggcacggcatcggc
ttcgtgatccaggcctaccagaagcgctgccccttcgtcatcgactggtgtgtcgacctg
gcgcgccgcagccagcaccgcctcatgatccgcctggtcaaaggggcctactgggacagc
gagatcaagcgcgcgcaagtggatggcttggcgggctatccggtctacacgcgcaaggcc
tacaccgacctgtcgtacctggcctgcgcacgtcagctgctggccgcgcccgagcaggtc
tacccgcagttcgccacgcacaatgcgcacacgctggcggcgatttaccagctggccgac
ccggcggcctggcagccggggcagtacgagttccagtgcctgcacggcatgggcgagccg
ctgtacgagcaggtggtcgggcacacagaaaatggcaagctgggccggacctgccgcatc
tacgcccccgtgggcacgcacgagacgctgctggcctacctggtgcgccgcctgctcgag
aacggcgccaacacctcgttcgtgaaccgcatcgccgaccccacggtcccgatcgccgcg
ctggtggcagacccggtcgcggccgtcgagcgcctggcgcagcaggggccccccctgggt
gcgccccaccccgccattcccctgcccgcccagctctacggcagcgcccgccgcaattcg
gacggcctggacctctcgaacgacgacagcctgcatgcgctggacgaggccctgacggcc
agcgccgccgtggcctggacggccgagcccctgctggcccagccggcggccgaaccggcc
gcagagggggtgccggtcgtcaacccggcggacgccagcgacgtggtgggccgggtctgg
cccgccagcgcagggcagttgcaacaggccctggccgccgcccacgccttcgcgccaagc
tgggcggccacgcccgtggccgagcgcgccgccgcgctggagcgcgcggccgaccacctg
cagcaacgcctgcccctactgctgggcctgctggcgcgcgaggccggcaaaacctgcgcc
aacggcgtggccgaggtccgcgaggccatcgacttcctgcgcttctacgcggcgcaggcg
cgcaccagcctggccacggccgcgcacacgccgctgggccctgtcgtctgcatcagcccc
tggaacttcccgctcgcgatcttcatcggccagatcgccgcggcactggccgccggcaac
cccgtgttggccaagcccgccgaacagacgccgctggtggctgccgagggcgtgcgcctg
ctgcatgcggccggcatccctgctgccgcccttcagctgctgccgggcgacggcgccacg
gtgggcgccgcgctcgtggccgacgcgcgcgtgcaggccgtgatgttcacgggctcgacc
gaggtcgcgcgccagatccagcaaacgctggcccagcgcctgggcgccggcggcgcgccc
gtgcccctgatcgccgagacgggcgggcaaaacgccatgatcgtcgactcctcggcgctg
gtggaacaggtcgtggccgacgtgctcggctcggccttcgacagcgcgggccagcgctgc
tcggcgctgcgcgtgctgtgcctgcaggacgaggtggccgaccgcgtgctgcacatgctt
cggggcgcgatggccgagctcacggtcggcaacccggcccggctcagcaccgacgtgggc
ccggtcatcgacgccgaggcgcgcgacaccctcgaagcccacatcgcccagatgcagcgc
gccggccgccaggtgcagcgcctgggccgcagcgcgccggacgtgccgggccgcggcacc
tacgtgctgccgacgctgatcgagattgagcacatcgccgagctgcagcgcgaggtcttc
ggccccgtgctgcacgtggtgcgcttcgcgcgcccggccctgggcacgctgctggcgcag
atcgccgccaccggctacggcctgacccagggcctgcacacgcgcatcgacgaaaccctg
cgcgaggttgcgcaacacgcccgcgtgggcaacctctacatcaaccgcaacctggtcggc
gcggtcgtgggcgtgcagccctttggcggccagggcctgtcgggcaccgggcccaaggcc
ggcggcccgctggtcctgcaccggctgggcgcgcacggggccggtatggcactgcaccag
gtggtcgccagcgccctgccgggggcgacacccgccgatgcgcccgccgacgtgcccgcc
aacgtgcccgcgcaggccccggccgctcatggcgcgctgctggcctggctcgggggccgg
catggcctgcgcctgcaccaggcctgcctgcgcctgccccaggcgctgggtccccatcgg
gcgtggctgctggcggggccgacgggcgagcgcaacgtctacagctggctgccccgcgaa
gccgtgctgtgcctggccgagcacgacgaggcgctgctgctgcagctggccgctgtgctg
gcggtgggtagccacgcgatctggccgctgcgggccgacacgcgggccctgcgcgccagc
ctgccgcacgaggtgcaggcgcacatcacgctgagccccgactggaccgcccccggcgtg
aggttcgacgtcgcgctggccgacggcgatgccgctggcctgcgcgccgcggcgcagcgc
ctggcggcgcgtgaggggcccatcgtcagcctgtggcggtgctcgatggaggcgatgccg
ctggaggccctgctgatcgagcgggccaccagcaccaacaccgccgccgcgggcggcaac
gccagcctcatgacgatcgcctga

DBGET integrated database retrieval system