KEGG   Campylobacter subantarcticus LMG 24377: CSUB8523_0612Help
Entry
CSUB8523_0612     CDS       T03572                                 

Gene name
pycA
Definition
(GenBank) pyruvate carboxylase, subunit A
  KO
K01959  pyruvate carboxylase subunit A [EC:6.4.1.1]
Organism
csf  Campylobacter subantarcticus LMG 24377
Pathway
csf00020  Citrate cycle (TCA cycle)
csf00620  Pyruvate metabolism
csf01100  Metabolic pathways
csf01120  Microbial metabolism in diverse environments
csf01200  Carbon metabolism
csf01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:csf00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    CSUB8523_0612 (pycA)
   00620 Pyruvate metabolism
    CSUB8523_0612 (pycA)
Enzymes [BR:csf01000]
 6. Ligases
  6.4  Forming carbon-carbon bonds
   6.4.1  Ligases that form carbon-carbon bonds (only sub-subclass identified to date)
    6.4.1.1  pyruvate carboxylase
     CSUB8523_0612 (pycA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CPSase_L_D2 Biotin_carb_N Biotin_carb_C Dala_Dala_lig_C ATP-grasp ATP-grasp_3 RimK ATP-grasp_4 ATPgrasp_ST DUF4634
Motif
Other DBs
NCBI-ProteinID: AJC92142
Position
577533..578972
Genome map
AA seq 479 aa AA seqDB search
MIHKILIANRGEIAVRVIRACRDLHIKSVAVYTEPDHECLHVKVADEAYRIGTDAIRGYL
DGKRIVEIAKACGADAIHPGYGFLSENYEFAKECEDAGIIFIGPKSDVIRKMGNKNIARY
LMKKNGIPVVPGTEKLNHCTLEEIKLQALKIGYPVILKASGGGGGRGIRVVHKEEDLEKS
FEACKREALSFFKNDEVFMEKYVINPRHIEFQILADNYGNIIHLCERDCSIQRRHQKIIE
IAPCPSISEKLRKTIGVTAVAAAKAVGYTNVGTVEFLLDDYNRFYFMEMNTRIQVEHPIT
EEITGIDLITRQIRIANGEILDLEQSDIKPRGFAIEARITAENVWKNFIPSPGKITEYFP
ALGPSVRVDSHLYKDYTVPPYYDSLLAKLIVKGSSYDSAVNRLERALKEFVIDDIRTTVP
FLIAITKIREFRRGYFDTSFIETHMEELLEKTEDRHQENKEEVIAAIAAALQKIKESRE
NT seq 1440 nt NT seq  +upstreamnt  +downstreamnt
atgatacataagattttaatagccaatagaggtgagatcgcagtcagagtaatccgtgct
tgtagggatttgcacataaaaagtgttgcagtttataccgaacctgatcatgagtgtttg
catgtaaaagttgcagatgaagcatatagaataggaacggatgctataagaggatatcta
gatggaaaaagaattgtagagatcgcaaaagcttgtggagctgatgcaatacatcctggc
tatggatttttgagcgaaaattatgaatttgctaaagaatgcgaggatgcggggatcatt
ttcataggcccaaaatcagatgttattcgcaaaatgggaaataaaaacattgcaagatat
ttgatgaaaaaaaatgggatccctgtggtgcctggaactgaaaaattaaatcattgtaca
ttagaagaaattaaacttcaagctttaaaaataggctatcctgtgattttaaaagccagt
ggcggcggcggtggtagaggtatacgtgttgtgcataaagaagaggatttggaaaaatct
tttgaagcttgtaagagagaagcgcttagcttttttaaaaatgatgaagtgtttatggaa
aaatatgttatcaatccaagacatattgagtttcaaattctagcggataattatggaaat
atcattcacctttgtgaaagagattgttctatccaaagaagacatcaaaaaattatcgaa
atagcaccttgtccgagtatttcagaaaaacttagaaaaaccataggagtaaccgctgta
gctgctgcaaaagcagtaggttatacgaatgttgggactgttgagtttttgcttgatgat
tataatagattttattttatggaaatgaatacgagaattcaagtagagcatcctatcaca
gaagaaatcacaggaattgatcttatcacaagacaaattcgtatcgctaatggagaaatt
ttagatttagaacaaagtgatattaaaccaagaggttttgctatagaagctagaattaca
gcagagaatgtgtggaaaaatttcattccaagtccaggtaaaatcaccgaatattttccg
gctttaggtccatctgtaagagtggatagtcatttgtataaagactatacggtgccgcct
tattatgattctttgcttgcaaaattaatcgtcaaaggttcaagttatgatagtgcggtt
aataggcttgagagggctttgaaggaatttgtgattgatgatataagaactactgtgcca
tttttgatcgcaattaccaaaataagggaatttagaagaggttattttgatacttctttt
atagaaacacacatggaagaacttttagaaaaaacagaagataggcatcaagaaaataaa
gaagaggtgattgctgcgattgctgctgctttacaaaaaataaaagaaagtagagaataa

DBGET integrated database retrieval system