KEGG   Cylindrospermum stagnale: Cylst_0708Help
Entry
Cylst_0708        CDS       T02398                                 

Definition
(GenBank) phosphate/sulfate permease
  KO
K03306  inorganic phosphate transporter, PiT family
Organism
csg  Cylindrospermum stagnale
Brite
KEGG Orthology (KO) [BR:csg00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99977 Transport
    Cylst_0708
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PHO4
Motif
Other DBs
NCBI-ProteinID: AFZ23036
UniProt: K9WTD0
Position
complement(800932..802176)
Genome map
AA seq 414 aa AA seqDB search
MPYTLVIVAILAFYVAWNLGANDVANAMGTSVGSKAVTLKQALIIAGVLEFSGAILFGQG
VTETLGTKIANPALFATTPQTLVIGMLTVLLSSGVWLQIATSRGLPVSSSHAVVGAIAGF
TWVALGASAIDWSSLGLITIGWILTPVISGAIAALFYSLIKHWILEQPDPVVQLQEWIPW
LSAILLSVFGVIVLPTLTQPLTNSLINQLGYNIPSHDIPLFTGAAAAIGLTFFSWRQLKN
SKIPNPVEGLFGRFQLLSACFVAFAHGSNDVGNAIAPLAVIVYINQTGGVPADSLTIPIW
ILILGGAGIVGGLAVWGKKVIATIGENIISLQPSSGFCAEIATATTILVASRLGLPVSTS
HALVGGVVGIGLVQNIKSIKFSTLQGIAAAWLITVPVSAVLSGAIFSIARIFFL
NT seq 1245 nt NT seq  +upstreamnt  +downstreamnt
atgccctataccctagttatagtcgccatactagccttttacgtcgcctggaatctcggc
gctaacgatgtcgccaatgcgatgggaacctctgtgggttccaaagctgtcaccttaaaa
caggcactaattattgctggggtattagagtttagcggtgctatcttgtttgggcaggga
gtcacagaaaccctaggaacgaaaattgctaaccctgccttattcgccacaacaccgcaa
acattagttattggcatgttaacggtactgctgtctagtggcgtgtggctgcaaattgcc
acatcacggggtttgcctgtatcctcatctcatgcagttgtcggtgcgatcgccggattt
acttgggtagccttgggcgcaagtgccatcgattggtcatcactaggcttaatcaccatt
ggctggattttaacacctgtaatcagtggtgcgatcgccgctttgttttacagtctgatc
aaacactggattttagaacaaccagatccagtagtgcagttacaagagtggataccctgg
ttaagcgcaattttattgagtgtatttggcgtaattgtcttaccaaccctcactcaaccc
ctgacaaactctttaattaaccaacttgggtacaacatcccttctcacgacatcccactt
tttacaggtgcagcagcagccattggactcaccttcttcagttggcgacaattaaaaaac
agtaaaatcccaaatcccgttgaaggattatttggacgatttcaattgttgagtgcttgc
tttgtcgcctttgctcatggttctaatgatgtcggaaatgcgatcgctcccttagctgta
atcgtctacatcaatcaaaccggtggcgtacccgcagatagtcttaccatccccatctgg
atactcatccttggtggtgctggcattgtcggtggtttagcggtttggggtaaaaaagtc
atcgccaccattggcgaaaacatcatttccttgcaacctagtagtggattctgtgccgaa
atcgccaccgccaccaccattttagtagcctcccgcttaggtttacccgtctcgacctcc
cacgcactcgttggcggtgtagttggtatcggactagtgcaaaatatcaaatcaattaaa
ttttcaactctccaaggaatcgccgccgcctggttaattacagtccccgtcagcgccgtt
ctcagcggtgctatttttagcattgcccggattttctttctttaa

DBGET integrated database retrieval system