KEGG   Cylindrospermum stagnale: Cylst_2195Help
Entry
Cylst_2195        CDS       T02398                                 

Definition
(GenBank) glutamyl-tRNA synthetase
  KO
K01885  glutamyl-tRNA synthetase [EC:6.1.1.17]
Organism
csg  Cylindrospermum stagnale
Pathway
csg00860  Porphyrin and chlorophyll metabolism
csg00970  Aminoacyl-tRNA biosynthesis
csg01100  Metabolic pathways
csg01110  Biosynthesis of secondary metabolites
csg01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:csg00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Cylst_2195
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    Cylst_2195
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:csg01007]
    Cylst_2195
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:csg03016]
    Cylst_2195
  09183 Protein families: signaling and cellular processes
   02048 Prokaryotic defense system [BR:csg02048]
    Cylst_2195
Enzymes [BR:csg01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.17  glutamate---tRNA ligase
     Cylst_2195
Amino acid related enzymes [BR:csg01007]
 Aminoacyl-tRNA synthetase
  Class I (A)
   Cylst_2195
Transfer RNA biogenesis [BR:csg03016]
 Eukaryotic Type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    Cylst_2195
 Prokaryotic Type
   Other AARSs
    Cylst_2195
Prokaryotic defense system [BR:csg02048]
 Toxin-antitoxin system (TA system)
  Type II TA system
   Type II TA system related factors
    Cylst_2195
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_1c
Motif
Other DBs
NCBI-ProteinID: AFZ24429
UniProt: K9WX84
Position
2577293..2578738
Genome map
AA seq 481 aa AA seqDB search
MTVRVRIAPSPTGNLHIGTARTAVFNWLFARHHGGTFILRIEDTDLERSRPEYTDNILEG
LRWLGLNWDEGPFYQSQRLHLYKEAVQKLLEQKLAYRCYTTSEELEAMREAQKARGDAPR
YDNRHRNLTPEQQAAFEAEGRSSVIRFKIEDEREIVWNDLVRGKMSWKGSDLGGDMVIAR
ASEDGIGQPLYNFVVVVDDIDMQISHVIRGEDHIANTGKQILLYEALGAKIPEFAHTPLI
LNMEGRKLSKRDGVTSISDFQQMGFTAEGLVNYMTLLGWSPPDSTQEIFTLDTAAKEFSF
ERVNKAGAKFDWDKLDWLNSQYLHSMPVDKLTDLLIPYWEGAGYNFAGGRERPWLEELVT
LLSASLTRLVDAVAMSKLFFSDVVEFSEEGSTQLQQAGSAAVLQGILTALEAQTQLSADT
AQNMIKQVVKEQNVKKGLVMRSLRAALTGDVHGPDLIQSWLLLNQIGLDKPRLSQAIAAA
N
NT seq 1446 nt NT seq  +upstreamnt  +downstreamnt
gtgactgttagagtccgtattgctccgagtccaactgggaatttacatattggtacagct
agaacggctgtgtttaactggttgtttgcccgccatcacggcgggacgttcattttgcgg
attgaagacacagatctagagcgatcgcgtcccgaatatacagataatatcctggaggga
ctgcgctggctgggtttgaactgggatgaaggtccattttaccaatcccaacgcctgcat
ctctacaaagaagcagtacaaaaactactagaacagaagttagcctaccgctgctacacc
acctctgaagaactagaggcgatgcgagaagctcaaaaagcgaggggcgatgctcctcgc
tatgacaaccgtcaccgcaatctcaccccagaacaacaggcagcttttgaagctgaaggt
cgctcttctgtgattcgtttcaaaattgaagatgagcgggaaattgtctggaatgaccta
gtacggggcaaaatgtcttggaaaggtagcgatctcggtggtgatatggtcattgctcgc
gcctctgaagatggcattgggcaaccactgtacaactttgtcgttgtagtagatgacatt
gatatgcaaatcagtcatgtgattcgcggagaagaccatatagccaacaccggcaagcaa
attttgctctatgaagcgttgggtgcaaaaatcccagaatttgcccacacaccgctgatt
ttgaacatggaagggcgcaagctttctaaacgggatggcgtcacttccatttctgacttt
cagcaaatgggtttcaccgccgaaggcttggtgaattacatgacattgctgggttggtct
cccccagactcaactcaggaaatattcaccttagatacagcagctaaggaatttagcttt
gagcgtgttaataaagcgggggctaagtttgactgggacaaactagattggttgaatagc
cagtatctccacagtatgccagtagataaactcacagatttgctcataccttactgggaa
ggagccgggtataattttgctggcggcagagagcgcccttggttagaggagctagttaca
ttactgagcgctagtctgactcggttggtggatgctgtcgcgatgagcaaactgtttttt
agcgatgtcgtggaatttagcgaggaaggaagtacacaacttcaacaagctggttcggct
gcggtgcttcagggaattctcacagccttggaagctcaaacccaattgtcagcagacacc
gcccaaaacatgattaagcaggtggtgaaagagcaaaatgtgaagaaaggcttggtaatg
cgatcgctccgagccgctttaactggagatgttcacggccccgacctgatccaatcctgg
ctattattaaatcagattggtttagataaaccgcgcttgagtcaagcgatcgccgcagcc
aattaa

DBGET integrated database retrieval system