KEGG   Cylindrospermum stagnale: Cylst_2449Help
Entry
Cylst_2449        CDS       T02398                                 

Definition
(GenBank) transcriptional regulator/sugar kinase
  KO
K00886  polyphosphate glucokinase [EC:2.7.1.63]
Organism
csg  Cylindrospermum stagnale
Pathway
csg00010  Glycolysis / Gluconeogenesis
csg00520  Amino sugar and nucleotide sugar metabolism
csg01100  Metabolic pathways
csg01110  Biosynthesis of secondary metabolites
csg01120  Microbial metabolism in diverse environments
csg01130  Biosynthesis of antibiotics
csg01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:csg00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Cylst_2449
   00520 Amino sugar and nucleotide sugar metabolism
    Cylst_2449
Enzymes [BR:csg01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.63  polyphosphate---glucose phosphotransferase
     Cylst_2449
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ROK Glucokinase DUF2993
Motif
Other DBs
NCBI-ProteinID: AFZ24666
UniProt: K9WXY9
Position
complement(2879431..2880138)
Genome map
AA seq 235 aa AA seqDB search
MVEDNGSVRTLSVDIGGSGVKAMVLDIAGKPLTERARLETPQPAKPEVVINAIVVLAAAQ
GDFHRVSVGFPGVVRCGVTETAVNLHPDWIGCDLATTLSKQLNKPVRVINDADMQGLGAI
AGKGVELVVTLGTGFGSALFIDGKLVPNMEMGHHQFRKGETYEEQLRRAALEQIGEKKWN
RRLEKAIASLQHLFNYDYLYIGGGEAVKVNMHLPLNVKLIPNVTGLLGGIALWKD
NT seq 708 nt NT seq  +upstreamnt  +downstreamnt
atggttgaagataatggatcagttcgcaccctatcagtggatattggcggtagtggtgtt
aaggctatggtgttggatatcgctgggaagcccttaacggaaagggcgcgtttagaaacg
ccccaaccggctaaaccggaggtagtgattaatgcaattgtggtgttagcagcggcacaa
ggtgattttcatcgtgtttccgtaggttttccgggtgtggtgcgatgtggcgttacggaa
acagcggtaaatttacatccagattggattggctgtgatttggcaacaaccttgtctaag
cagttaaacaaacctgtgcgggtgattaatgacgctgatatgcagggtttaggtgcgatc
gcaggcaagggtgtagaattagtggtgaccctggggactggctttggttcggcgttgttt
atcgatggtaaattggtgccaaatatggaaatgggacatcatcagtttcgcaaaggggag
acttatgaagaacaactccgacgggcagctttggaacaaattggtgagaaaaagtggaat
cggcggttagaaaaagcgatcgcttctttgcagcatctcttcaattatgactacctttac
atcggtggtggtgaagctgtcaaggtgaatatgcatctgccattaaatgtgaaactcatc
cccaatgtcaccggtttattaggtgggattgctttgtggaaagattag

DBGET integrated database retrieval system