KEGG   Cylindrospermum stagnale: Cylst_2748Help
Entry
Cylst_2748        CDS       T02398                                 

Definition
(GenBank) fatty-acid desaturase
  KO
K00507  stearoyl-CoA desaturase (Delta-9 desaturase) [EC:1.14.19.1]
Organism
csg  Cylindrospermum stagnale
Pathway
csg01040  Biosynthesis of unsaturated fatty acids
csg01212  Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:csg00001]
 Metabolism
  Lipid metabolism
   01040 Biosynthesis of unsaturated fatty acids
    Cylst_2748
Enzymes [BR:csg01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.19  With oxidation of a pair of donors resulting in the reduction of O2 to two molecules of water
    1.14.19.1  stearoyl-CoA 9-desaturase
     Cylst_2748
Lipid biosynthesis proteins [BR:csg01004]
 Desaturase
  First
   Cylst_2748
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FA_desaturase Pkr1
Motif
Other DBs
NCBI-ProteinID: AFZ24945
UniProt: K9WX42
Position
complement(3220129..3220986)
Genome map
AA seq 285 aa AA seqDB search
MPAKFLAIAPEGGQALRLSWTNVAFFAAVHALALLAPWFFSWSALGLLLFLHWLFGSIGI
CLGYHRLLSHRSFQVPKGLEYAIAFIGALALQGGPISWVGAHRQHHAHTEDIHLDPYSAQ
RGFWWSHILWILYPRPEFFDYQIYQKFAPDLARQPFYRWLDRYFLLLQVPLAVLLYALGG
WSFVIYGMFVRTVLIWHSTWFVNSASHIWGYRTFESNDGARNLWWVSLVTYGEGWHNNHH
TYPHMAKSGLRWWEIDVTWWSIKALQTLGLAKKVISSPPQGAGQG
NT seq 858 nt NT seq  +upstreamnt  +downstreamnt
atgcccgcaaaatttctggcgatcgcccctgagggaggccaagcactacgcctcagttgg
acgaatgtggcattttttgccgcagttcatgctttagctctcttggccccttggtttttc
tcctggtcggcactaggtttgctgctatttctccactggttgtttgggagtatcggcatt
tgcctggggtatcatcgattgttaagccatcggagtttccaagtgcccaaagggttagaa
tatgcgatcgccttcattggagcacttgcacttcaaggaggccccatttcctgggttggc
gcacatcgccagcatcacgcccacactgaagatattcacctcgacccctactcggctcaa
cgaggcttttggtggagccatattctgtggattttatatcctcgtccagagttttttgat
taccaaatttatcaaaaattcgcgccagacctcgcacgccaaccattttaccgctggtta
gatcgctactttttgctgctacaagttccccttgccgtgctgctgtatgctttaggcggc
tggtcttttgtgatttacgggatgtttgtcaggacagtattgatttggcattccacttgg
tttgtgaattctgcatctcacatctggggctatcgcacctttgaaagcaacgacggtgcg
cgtaatctgtggtgggtatccctggtaacttatggagaaggatggcacaacaaccatcat
acttatccccacatggcaaaatcaggattgcgctggtgggaaattgatgttacttggtgg
agtattaaagccttgcagactctaggtttagccaaaaaggtgatttcatctccccctcaa
ggtgcaggtcaaggttga

DBGET integrated database retrieval system