KEGG   Cylindrospermum stagnale: Cylst_3834Help
Entry
Cylst_3834        CDS       T02398                                 

Definition
(GenBank) Nucleoside-diphosphate-sugar pyrophosphorylase family protein
  KO
K00966  mannose-1-phosphate guanylyltransferase [EC:2.7.7.13]
Organism
csg  Cylindrospermum stagnale
Pathway
csg00051  Fructose and mannose metabolism
csg00520  Amino sugar and nucleotide sugar metabolism
csg01100  Metabolic pathways
csg01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:csg00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    Cylst_3834
   00520 Amino sugar and nucleotide sugar metabolism
    Cylst_3834
Enzymes [BR:csg01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.13  mannose-1-phosphate guanylyltransferase
     Cylst_3834
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NTP_transferase NTP_transf_3 Hexapep
Motif
Other DBs
NCBI-ProteinID: AFZ25950
UniProt: K9X006
Position
4351809..4352975
Genome map
AA seq 388 aa AA seqDB search
MKAMILAAGKGTRVRPITYTIPKPMIPILQKPVMEFLLELLRQHGFDQIMVNVSHLAEEI
ENYFRDGQRFGVQIAYSFEGQIVDGKLEGAAIGSAGGMRRIQDFSPFFDDTFVVLCGDAL
IDLDLTAAVKWHKSKGSIATIITKSVPEEEVSSYGVVVTDEDHRVKAFQEKPSTEEALST
NINTGIYIFEPEVFNYIPSEVEYDIGSQLFPKLVEINAPFYAIPMDFEWVDIGKVPDYWR
AIRGVLLGEIKNVQIPGHEVAPGIYTGLNVAVNWDKVEITGPVYIGGMTRIEDGAKIVGP
AMIGPNCWICSGATVENSVIFEWSRLGPGVRLVDKLVFGRYCVDKTGAAIDVQAAALDWL
ITDARQTPPSNTPVERQAIAELLGTNAN
NT seq 1167 nt NT seq  +upstreamnt  +downstreamnt
atgaaagcgatgattctcgcggcaggtaagggtactcgcgtgcgtcctattacctatacc
attcccaaaccgatgattcccatcctgcaaaagccagtgatggaatttttgctggaatta
ttacgccaacatggatttgaccagattatggtcaatgttagccatttagctgaagaaata
gaaaactatttccgtgatggtcagcggtttggtgtgcagattgcctattcgtttgaaggg
caaattgttgatggtaaactcgagggcgctgccatcggctctgctggggggatgcggcga
attcaagacttctcgccattttttgatgatacttttgtggtgttgtgcggtgatgctttg
attgacttggatttgactgcggcagttaagtggcataaatctaaggggtcaattgctacc
atcatcacgaaatctgtccccgaagaagaagtttctagttacggtgtggtcgtcactgac
gaagatcatcgcgtcaaagctttccaagaaaaaccctcaacagaagaagccctcagtacc
aacatcaatacaggtatttacatctttgagcctgaggtttttaattatatcccctcagaa
gtagagtatgacattggtagccaattgttccccaaactggtggaaatcaatgcccctttc
tacgctatcccaatggattttgaatgggtagatattggtaaagtaccagattactggcga
gcgattcgcggtgtacttctaggggaaatcaaaaacgtgcaaattcctggtcatgaagtt
gctcctggaatctacactggcttaaatgttgctgtgaattgggacaaagtggagatcaca
ggcccagtttatattggcgggatgacgagaatcgaagacggggcaaaaatcgtcgggcca
gcgatgatcggccctaattgctggatatgcagcggtgcaacagtagaaaacagtgtgatt
tttgaatggtcgcgcttagggccgggagtccgcttggttgataagctggtgtttggacgt
tactgcgtggataagaccggggcggcgatagatgtccaagctgctgctttagactggctg
attaccgatgcccgtcagacaccaccatccaacacccctgttgagcgacaagcgatcgct
gaattgttggggacaaatgctaattag

DBGET integrated database retrieval system