KEGG   Clostridium saccharolyticum WM1: Closa_0256Help
Entry
Closa_0256        CDS       T01288                                 

Definition
(GenBank) ABC transporter related protein
  KO
K10820  galactofuranose transport system ATP-binding protein [EC:7.5.2.9]
Organism
csh  Clostridium saccharolyticum WM1
Pathway
csh02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:csh00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    Closa_0256
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:csh02000]
    Closa_0256
Enzymes [BR:csh01000]
 7. Translocases
  7.5  Catalysing the translocation of carbohydrates and their derivatives
   7.5.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.5.2.9  ABC-type D-galactofuranose transporter
     Closa_0256
Transporters [BR:csh02000]
 ABC transporters, prokaryotic type
  Saccharide, polyol, and lipid transporters
   Galactofuranose transporter
    Closa_0256
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ABC_tran AAA_21 RsgA_GTPase SMC_N AAA_29 AAA_13 SbcCD_C AAA_30 MMR_HSR1 AAA_23 DLIC AAA_25
Motif
Other DBs
NCBI-ProteinID: ADL02896
UniProt: D9R205
Position
279729..281249
Genome map
AA seq 506 aa AA seqDB search
MPNDIVLAMRSISKTFPGVKALDHVDFTLRRGEVHALMGENGAGKSTLIKVLTGVEEFES
GEITIDGFPGNRINHSPQEAQAHGISTVYQEVNLCPNLSVAENLFIGREPKRAGLIDWKT
MNKRAKDLLEGLDIHIDVTRALENYSIALQQMFAIARAVDMSAKVLILDEPTSSLDDHEV
EKLFKLMKRLKSEGVGIIFVTHFLEQVYEVCDRITVLRNGALVGAYETEKLPRVQLVAKM
MGKDFDDLAAIKKRGDSRERSEEVVIHAKEIGKQGSIKPYDLTIRKGEVIGLTGLLGSGR
SELARSLYGADKPDSGELKVKGRPVSVTAPHDAMMAGMAYLPENRKEEGIVADLTVRENL
ILAIQAKKGMLHPIGRKEQEELADKYIELLQIKTASRETPIKSLSGGNQQKAVLGRWLLT
DPDFLILDEPTRGIDVGTKTEIQKLVVKLSEEGKSVMFISSEIEEMLRTCNRMAVLRDGQ
KVGELEEEELDQNNIMKAIAGGTEDE
NT seq 1521 nt NT seq  +upstreamnt  +downstreamnt
atgcccaatgatatcgtattagccatgcggagcatatcaaaaacatttccaggcgtgaag
gcccttgatcatgtggattttaccttaagaaggggggaggtccatgccctgatgggagaa
aacggagccggaaaatccactcttatcaaggttttgacaggagtggaagagtttgaatca
ggagaaatcaccattgacgggtttccggggaacaggatcaaccattctccccaggaggcc
caggctcatgggatcagcacggtctatcaggaggtcaatctctgtcccaacttatctgta
gcagaaaacttatttatcggcagagagccgaaacgggcaggcttgatcgactggaaaacc
atgaataaacgggcaaaagaccttctggaaggtctggatatccacatagatgtgaccagg
gccctggaaaattactccatcgccctgcagcagatgtttgccattgccagggcagtggat
atgtccgcaaaggttttgatccttgacgaacccacctcttccctggatgaccatgaggtg
gagaagctgtttaagctgatgaagcgactgaagtcggaaggggtcggcatcatttttgtc
actcatttcttagagcaggtgtatgaggtatgcgacaggattacggttcttagaaacggg
gctttagtaggagcgtatgaaacggaaaaactgcccagagtgcagttggtggctaagatg
atgggaaaggattttgacgatttggctgccataaagaaacggggagattccagggaaaga
tcagaggaagtggtgatccatgcaaaggagatcggaaagcagggaagcattaagccttat
gaccttaccatacggaagggggaagtgatcggtcttacggggcttttaggctccggccgc
tcggagctggccagaagtctttacggagcggataagccggacagcggagagctgaaggta
aaaggccgtccggtttcagtgactgctcctcatgatgccatgatggctgggatggcttat
cttccggaaaacaggaaagaagaaggaatcgtagcggatttaactgtgagggagaacctt
attctggcgattcaggcaaagaagggcatgcttcatcccattggaagaaaagagcaggag
gagcttgcagataaatatattgagcttttacagatcaagacagccagcagagagaccccc
ataaagagcttaagcggaggaaaccagcagaaggcggtcttaggaagatggttacttacg
gacccggatttccttattttggatgaacccaccagagggatcgatgtagggaccaagaca
gagattcagaagctggtggtaaagctttcagaggaggggaaatccgtgatgttcatttcc
tcggaaatagaggaaatgctgcgtacctgcaaccgcatggctgtgctcagggatgggcag
aaggtgggagagctggaggaagaggaactggaccagaacaacattatgaaggcgattgca
ggaggtacggaagatgaatag

DBGET integrated database retrieval system