KEGG   Clostridium saccharolyticum WM1: Closa_0463Help
Entry
Closa_0463        CDS       T01288                                 

Definition
(GenBank) threonine synthase
  KO
K01733  threonine synthase [EC:4.2.3.1]
Organism
csh  Clostridium saccharolyticum WM1
Pathway
csh00260  Glycine, serine and threonine metabolism
csh00750  Vitamin B6 metabolism
csh01100  Metabolic pathways
csh01110  Biosynthesis of secondary metabolites
csh01120  Microbial metabolism in diverse environments
csh01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:csh00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Closa_0463
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    Closa_0463
Enzymes [BR:csh01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     Closa_0463
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thr_synth_N PALP
Motif
Other DBs
NCBI-ProteinID: ADL03100
UniProt: D9R3Y7
Position
526550..528034
Genome map
AA seq 494 aa AA seqDB search
MELSYQSTRGGEAGVTASQAILKGLAEDGGLFMPCFIPKLDKSMKELSAMTYQETAYEVM
KLYLTDYSEGELKTCIERAYDSKFDTEEIAPLAKAGGSYYLELYHGSTIAFKDMALSILP
HLMTVAAKKNEVKNKIVILTATSGDTGKAAMAGFADVEGTEIIVFYPKDGVSRVQELQMV
TQKGENTHVAAIHGNFDDAQTGVKKIFGDKEFARKLAEKGFQLSSANSINIGRLVPQVVY
YVYAYAKLLSSGEIADGEVINVTVPTGNFGNILAAYLAKQMGVPIKTLICASNENKVLYD
FFQTGTYDRNRDFILTSSPSMDILISSNLERLIYLSAGCDADANAAFMKDLSENGAYTVT
DFMRGFMDDFKGGFAGEEETRAAIKKVFDDTGYLMDPHTGVAACVYDRYRTKTKDHTKNV
IASTASPYKFSRSVLEAMEGKQEEPDEFRVIDHLAEVSRVPVPQAVEEIRTAPVRHNTEC
DVDKLKEAVEGFLS
NT seq 1485 nt NT seq  +upstreamnt  +downstreamnt
atggaattatcctatcaaagcaccaggggcggtgaagccggtgtaacggcttcccaggca
atcttaaagggactggcagaagacgggggcctgtttatgccgtgttttatcccaaagctt
gacaaatccatgaaggaactgtcggcaatgacatatcaggaaacggcctatgaggtcatg
aagctgtaccttacggattattcagagggggagttaaaaacctgcattgaacgggcttat
gacagcaaattcgatacagaggagattgctcccttagcaaaggccggcggctcctattat
ctggaattatatcatggtagtaccattgcatttaaggatatggctctttccattctccct
catctcatgaccgttgccgcaaaaaagaatgaggtaaaaaataaaattgtgatcctcacg
gctacctccggagatacaggaaaagctgccatggcaggctttgccgatgtggaagggacg
gaaatcattgtattttacccaaaggatggggtaagccgggtccaggagcttcagatggtg
acccagaagggagaaaacacccatgtggctgccattcatggaaactttgacgatgcccag
acaggggtgaagaagattttcggtgataaggaatttgcacgtaaactggctgaaaagggc
tttcagctttcctctgccaactccatcaacatcggaaggctggttccccaggttgtctac
tatgtctatgcttatgcaaagctgctttccagcggggagatcgcagatggagaagtgatc
aatgtgaccgtacccacaggaaacttcgggaacattctggcagcttacttagcaaaacaa
atgggagttcccattaaaaccctgatctgtgcctccaatgaaaataaagttctttatgat
ttctttcagaccggaacctatgaccggaaccgtgatttcatacttaccagctctccgtcc
atggatattctgatttccagcaacttagagcgcctgatttatttaagcgccggatgtgat
gcggatgcaaatgccgctttcatgaaggacttaagtgaaaacggagcctatacggtaacc
gattttatgaggggattcatggatgattttaagggaggctttgcaggagaagaggagacc
agggcagccattaagaaggtatttgatgatacgggatatctgatggatccccatacaggt
gtggccgcctgtgtgtacgacaggtacaggacaaagacaaaggatcacacaaagaatgtt
atcgcttccacggcaagtccctataaattctcaagaagcgttctggaagccatggaaggg
aaacaggaagagccggatgaattccgggtcattgaccatctggcagaggtctccagggtt
cctgttccccaggcagtggaagaaatccgcactgcaccggtacgccataatacggaatgc
gatgtcgataagctgaaggaagcggtggaaggctttttaagctaa

DBGET integrated database retrieval system