KEGG   Clostridium saccharolyticum WM1: Closa_1023
Entry
Closa_1023        CDS       T01288                                 

Definition
(GenBank) aldehyde oxidase and xanthine dehydrogenase molybdopterin binding protein
  KO
K00087  xanthine dehydrogenase molybdenum-binding subunit [EC:1.17.1.4]
Organism
csh  Clostridium saccharolyticum WM1
Pathway
csh00230  Purine metabolism
csh01100  Metabolic pathways
csh01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:csh00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    Closa_1023
Enzymes [BR:csh01000]
 1. Oxidoreductases
  1.17  Acting on CH or CH2 groups
   1.17.1  With NAD+ or NADP+ as acceptor
    1.17.1.4  xanthine dehydrogenase
     Closa_1023
SSDB
Motif
Pfam: Ald_Xan_dh_C2 Ald_Xan_dh_C
Other DBs
NCBI-ProteinID: ADL03640
UniProt: D9R6Y4
Position
1117310..1119592
AA seq 760 aa
MIIGKSVARVDAFDKVTGRSKYTDDLCEKNALVAKIYHSAIANGKVTSIDTSEAEKIPGV
VKVVTCFDVPKIYFPTAGHPWSTDTSHQDVADRLLLTDRVRFCGDDVAAVIAESEIAAKQ
AIKALKVEYEEYPFVLDVQEAMEEGAPQLHEKYSNNILGHSSIRKGNIEEAIKEPGLIKI
DQWYDTPIVQHCHIENHICFASMENGKITVVSSTQIPHIVRRVVGQALGIPWGSVRIVKP
YIGGGFGNKQDALYEPLCAYLSKVVGGRLVKLDVTREETFVSNRTRHAIRSHIISWVRPD
GTFAARKLECFSNQGAYASHGHGIAAKGMNAFPQLYPCENIECDSYTVFTNLPVAGAMRG
YGIPQAMFPVESQSDDIAQAIGMDPVEFRRKNLMPVGYVDGFSKNENYFDTFNQCLEKGK
AYIDFDRKRKEYANQTGPVRKGIGCAVFWYNTAVWPISLESSSCRMVLNQDGSVQVQLAE
TEIGQGADTAFAQMTADTLGIPFEMVHVISSQDTDVTPFGTGAYASRQTYVAGFSIKQTA
LLLKERILNYAHELTRMPVFNLDIRDGRIVRTTDGRELLTLEELSTEAIYSLSHSQHLTS
ESTYQIKSNAYSFGCCFAEVEVDIPMCKVKLVDIINVHDCGQLINPALAQAQVHGGMSMG
IGYALSEQLLIDEKTGRTLNDNLLDYKLSTTMDHPHLEAQFVENYEPTSAFGTKSLGEPP
ACPVAPAIRNAILNATGVSMYQIPMTSQAVFKRFKEEGLI
NT seq 2283 nt   +upstreamnt  +downstreamnt
atgataatcggaaaaagtgttgcccgtgttgatgcatttgacaaagtcacgggaagatcc
aaatacaccgatgatctttgtgagaaaaatgctctggtagcgaaaatttaccattctgcc
atagccaatggaaaggttacatccattgatacttcagaggcagaaaaaataccgggagtg
gttaaggtagtgacctgttttgacgtaccaaagatctatttcccgacagccggtcatcca
tggtctacggatacaagccatcaggatgtagcagaccgtctgctcttaacagaccgggtg
cgtttctgcggcgatgatgtggcagcagtaattgcggaaagtgaaatagctgctaaacag
gcgatcaaggcgttaaaggtggaatatgaggagtatccctttgttcttgacgtccaggag
gctatggaagagggggcacctcagcttcacgaaaaatatagcaataacattctgggtcat
tccagcataagaaaagggaatatagaagaggctattaaggagccgggcttaattaagatc
gaccagtggtatgatactcccattgttcagcactgccatattgaaaaccatatttgtttt
gccagtatggaaaacggaaaaataaccgtggtatcttccacccagattcctcatatcgtc
agaagagtggtggggcaggctcttggaattccatggggaagcgtccgcatcgtcaaaccg
tatatcggaggcggttttggtaacaagcaggatgcgttatatgagcctctttgtgcctat
ctttcaaaggtcgttggaggacgtctggtaaaacttgatgtgaccagggaggaaaccttt
gtaagcaaccgtacaagacacgccatccgcagtcatatcatcagctgggttcgtcctgac
ggtacctttgcggcccgcaagctggagtgcttttccaaccagggagcctatgcttctcac
ggacatggaatcgcagcaaagggaatgaacgcgtttccccagttgtatccatgtgaaaat
atagaatgcgattcctatacggtattcaccaatttgcctgtggcaggagccatgcgaggc
tacgggatccctcaggccatgttcccagtggaaagccagtccgatgacattgctcaggca
attggcatggacccggtggaattccgccgtaaaaaccttatgcccgttggttatgttgat
ggtttttctaaaaatgaaaattactttgatacctttaaccagtgcctggaaaagggaaaa
gcatatatagactttgaccggaaaagaaaggaatacgcaaaccagaccggacctgtccgt
aaaggcattggctgtgcggttttctggtataatactgcagtatggcctatcagcttagag
tcctcttcctgccggatggtgctgaaccaggacggttccgtacaggtgcagctggcagag
acagagatcggccagggagctgatacggcttttgcccaaatgacggcagataccctggga
attccttttgaaatggttcatgtgatttccagccaggatacggatgttactccctttggt
actggagcctatgcgtcaaggcagacctatgtagcaggcttttccattaagcagacggcg
cttttattaaaagagagaatcttaaattatgctcatgagctgaccagaatgccggtcttt
aacctggatatcagagatggaagaatcgtgcggaccacggatggaagggagcttctgacc
ctggaagaattatcgactgaggccatttacagtctttcccacagccagcatctgacctca
gaaagcacttaccagattaagtccaacgcatattcctttggctgctgctttgccgaggta
gaagtggatattcccatgtgcaaggtaaagctggttgacattatcaatgtccatgactgc
ggacagctgatcaatccggctctggcccaggcccaggtccatggaggcatgagcatggga
atcggctatgccctttctgagcagcttctcattgatgaaaagacaggcagaacattaaat
gataatctgttggattataaattatccactactatggatcatcctcatctggaggcacag
tttgtggagaattacgaacctaccagcgcatttggaacaaagtccctgggggaacccccg
gcctgtccggtggcaccggccatccgcaatgccatattaaatgcaacaggtgtttccatg
taccagatacccatgacatctcaggcggtatttaaacggtttaaggaagagggactaatc
tga

DBGET integrated database retrieval system