KEGG   Clostridium saccharolyticum WM1: Closa_1135Help
Entry
Closa_1135        CDS       T01288                                 

Definition
(GenBank) Formate--tetrahydrofolate ligase
  KO
K01938  formate--tetrahydrofolate ligase [EC:6.3.4.3]
Organism
csh  Clostridium saccharolyticum WM1
Pathway
csh00670  One carbon pool by folate
csh01100  Metabolic pathways
csh01120  Microbial metabolism in diverse environments
csh01200  Carbon metabolism
Module
csh_M00140  C1-unit interconversion, prokaryotes
Brite
KEGG Orthology (KO) [BR:csh00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00670 One carbon pool by folate
    Closa_1135
Enzymes [BR:csh01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.4  Other carbon-nitrogen ligases
    6.3.4.3  formate---tetrahydrofolate ligase
     Closa_1135
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FTHFS Tho1_MOS11_C
Motif
Other DBs
NCBI-ProteinID: ADL03749
UniProt: D9R7M0
Position
1233224..1234894
Genome map
AA seq 556 aa AA seqDB search
MKTDVQIAQEANMLPIAEVAKNLGILEDELELYGKHKAKVSLDVLKRLENKPDAKLVLVT
AINPTPAGEGKTTTNVGLSMGLNKIGKKAITALREPSLGPCFGVKGGAAGGGYAQVVPMD
DINLHFTGDFHAITSAHNLLAALLDNHLHQGNALRIDPKKIVWKRVVDMNDRSLRNIIVG
LGGKGDGVVRQAGFDITVASEIMAILCLATSMSDLKERLSRMVVAYNTDGNPVTAGDLEA
TGAMALLLKDAIKPNLVQTLENTPAFIHGGPFANIAHGCNSVLATKVALKLADYVITEAG
FGADLGAEKFFDIKCRFAGLNPDAVVIVATVRALKMNGGVPKTELSTENLNALEKGIANL
ERHLENLEKFGVSAVVAINKFPADTEAELELLREKCAARGVEVILSDVFAKGGEGGIALA
SKVVKICETKKSNYAPLYDVDGSIAEKITTIAQEIYRADGVDFTADAKKQIAELEKLSLD
KMPICMAKTQYSFSDNANLLGAPIGFRITVREVKVSAGAGFIVAITGDIMTMPGLPKVPA
ANGMDITEDGVIIGLS
NT seq 1671 nt NT seq  +upstreamnt  +downstreamnt
atgaaaacagatgtacagattgcacaggaggctaacatgcttccgatagcagaggttgca
aagaatcttggaattttggaggatgaactggagctttacggtaagcataaggcaaaggtt
tctttggatgtattaaaaagacttgaaaataagccggatgccaagttggtacttgttact
gctatcaaccctactccggcaggtgagggaaagaccacaactaatgttggtttatccatg
ggacttaataaaatcggaaaaaaggccattacagctctccgggagccgtcgctgggacct
tgcttcggtgtaaaaggaggagctgccggaggcggatatgctcaggttgtaccaatggat
gatattaatcttcactttacaggagattttcatgctattacatccgcgcacaatctgtta
gctgccctccttgataatcatcttcatcagggaaatgctctgcggattgaccctaaaaag
atcgtgtggaaaagagtcgtggatatgaatgacaggtctctcagaaacatcatcgtgggt
cttgggggaaagggcgacggagtggtgagacaagccggattcgatattacagttgcatcg
gaaattatggcaattctttgcttggctaccagcatgtctgacttaaaggaacgtctttcc
agaatggtagtagcttataatacagatggtaacccagtcactgcgggagatctggaagca
acaggagctatggcactgctgttgaaggatgcaattaagccaaatctggtacagacattg
gagaacacacctgcgtttattcacggaggaccctttgccaatatagcacatggctgtaat
tccgtacttgcaacgaaggttgctttaaaactggccgactatgtaataacggaagccggc
tttggggctgatcttggggctgagaaattctttgatatcaagtgcagattcgcagggctg
aatccggatgcggtggttattgttgcgacagtaagagctctaaaaatgaatggtggagta
ccgaagacagaactgtcaactgaaaacctcaatgcattggaaaagggaatagcaaacctg
gagagacatctggaaaaccttgagaaatttggtgtttccgcagttgttgcaattaataaa
ttccccgctgatacagaagcggaattagagttgctcagagagaaatgtgcagccaggggt
gttgaagtaattctctccgatgtatttgcaaaaggaggagagggtggcattgcccttgct
tcgaaggtagtgaaaatatgcgaaacaaaaaaatcaaattatgcacccctttatgatgtg
gatggctctatagctgagaaaatcacaaccattgcgcaggagatatacagagcggacgga
gtcgattttacggctgatgctaagaaacagattgcagagcttgaaaaactcagcttggat
aagatgccgatctgtatggcaaaaacccagtattcattctcggataatgccaatctgctg
ggagcacctataggtttccgtatcacagtaagagaagttaaggtatcggcaggagcgggg
tttatagtggctattaccggcgatatcatgactatgccgggtcttcccaaagttcctgct
gccaatggtatggatattacagaagatggagttattattggtttatcctaa

DBGET integrated database retrieval system