KEGG   Clostridium saccharolyticum WM1: Closa_1697Help
Entry
Closa_1697        CDS       T01288                                 

Definition
(GenBank) PHP domain protein
  KO
K07053  3',5'-nucleoside bisphosphate phosphatase [EC:3.1.3.97]
Organism
csh  Clostridium saccharolyticum WM1
Brite
KEGG Orthology (KO) [BR:csh00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    Closa_1697
Enzymes [BR:csh01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.97  3',5'-nucleoside bisphosphate phosphatase
     Closa_1697
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PHP
Motif
Other DBs
NCBI-ProteinID: ADL04293
UniProt: D9QZ42
Position
complement(1801966..1802820)
Genome map
AA seq 284 aa AA seqDB search
MKFVDLHVHSNASDGTLTPSQVVALAAENNLGAIALTDHDTIDGLSEAQAAASGLPIEII
PGIELSCVYQGEEIHILGLYVDPTDKAFVSETNTLKEIRKKRNEEMIRRFQNAGISITFD
EVMAGNPDTVITRAHFARVLLEKGYVKSMDQAFKKYLDYNGPYCPRKEKISPGHAIKILT
DCKASPVLAHPYQYHLGDNKTEELVRYLKELGLHGLEVYHSSNNQYESGKLKKLAGKYDL
FPTGGSDFHGSNKPDISLGFGRGGLRITDLLLDDIKRIRREKGL
NT seq 855 nt NT seq  +upstreamnt  +downstreamnt
atgaaatttgtcgatttgcatgttcattccaatgcttccgatggcacccttaccccctcc
caagtggtggccctggcagcggagaacaatcttggggccatagccctcaccgatcacgat
accattgacggcctttcggaagcccaggctgccgcatccggtcttcctattgaaatcata
ccgggaattgagctctcctgtgtgtaccagggagaagaaattcatatcctggggctttat
gtggatccaacagataaggcgttcgtctccgaaacgaatacgcttaaggaaattcggaaa
aaaaggaacgaggaaatgatacgccgcttccaaaatgccggcatttccatcacattcgat
gaagtaatggcaggaaatcctgacacggttattacacgggctcattttgccagggttctc
ctggaaaagggctatgtaaaaagcatggatcaggcatttaaaaaatacctggactacaac
ggcccttactgcccccgcaaagaaaagatctcccccgggcatgccataaaaatccttaca
gactgcaaagcatctcctgttctggcccatccataccagtatcatctgggggataataaa
actgaggagctggtccgctatttaaaggagctgggacttcatggcctggaagtctatcac
tcttccaacaaccaatatgaaagcggcaaactgaaaaagctggccggaaagtatgatctc
tttcccactggcggttctgattttcacggaagcaacaagcctgacatcagcctgggtttt
ggccggggaggacttaggataaccgatctgctgcttgacgatataaaaaggattcggcgg
gaaaagggcctttga

DBGET integrated database retrieval system