KEGG   Clostridium saccharolyticum WM1: Closa_2199Help
Entry
Closa_2199        CDS       T01288                                 

Definition
(GenBank) phosphoenolpyruvate carboxykinase (ATP)
  KO
K01610  phosphoenolpyruvate carboxykinase (ATP) [EC:4.1.1.49]
Organism
csh  Clostridium saccharolyticum WM1
Pathway
csh00010  Glycolysis / Gluconeogenesis
csh00020  Citrate cycle (TCA cycle)
csh00620  Pyruvate metabolism
csh01100  Metabolic pathways
csh01110  Biosynthesis of secondary metabolites
csh01120  Microbial metabolism in diverse environments
csh01130  Biosynthesis of antibiotics
csh01200  Carbon metabolism
Module
csh_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:csh00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Closa_2199
   00020 Citrate cycle (TCA cycle)
    Closa_2199
   00620 Pyruvate metabolism
    Closa_2199
Enzymes [BR:csh01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.49  phosphoenolpyruvate carboxykinase (ATP)
     Closa_2199
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPCK_ATP AAA_33
Motif
Other DBs
NCBI-ProteinID: ADL04777
UniProt: D9R2C7
Position
complement(2367225..2368916)
Genome map
AA seq 563 aa AA seqDB search
MSTKAYYPINEIGKGKPGFATTRSIIEAPFYGNNVIKVNTLREAYELAKNSPGTVVTDMP
VYRGEEFGLDKDAKVLLFNDGAITGRYATARRIAGEPGVNCGALDKVVMDAVYETRWKTM
YHAEVFAGLDPEFMVKVHLLIPEGEENILYNWMLNFQYMSDEYAKMYKASKPIGDGKEAD
IYIFSDPQWNGSDRPGVDLSCLSDPKCLCYFNTDQNCAAILGMRYFGEHKKGTLTMVWAL
ANRNGYASCHGGQKEYNLTDGSKYVASVFGLSGSGKSTITHAKHGGKYDVTVLHDDAFII
NTDTCSSVAIEPTYFDKTQDYPTGCEDNKYLLTAQNCSCTLDEDGKIQLVTEDIRNGNGR
AIKSKLWSPNRVDKIDAPVNAIFWIMKDPTIPPVVKLKGASLASVMGATLATKRSSAERL
APGADPNALVVVPYANPFRTYPLANDYEKFKKLVEEKNVDCYIINTGDFMGKKVQPKDTL
GILEAIVDKTAQFKQWGPFSDIEIFEWEGFVPNLDDAAYAEQLKARMEDRVKFVANTAVV
KEGYDKLPDDALAALEKIVAELK
NT seq 1692 nt NT seq  +upstreamnt  +downstreamnt
atgtcaacaaaagcttattatccaatcaatgaaattggaaagggtaaaccaggttttgca
actacgcgttcgatcattgaagctccgttttatggaaacaacgtaattaaagttaataca
cttagagaggcatatgaactggcaaaaaattcaccaggaaccgtggtaacggatatgccc
gtatacagaggagaggaatttggcctggataaggatgccaaggttctcttatttaatgat
ggtgcgataaccggacgttatgcgaccgcaagaagaattgcaggagaacccggtgtaaat
tgcggcgctctagataaagttgttatggacgcagtttatgagacccgctggaaaacaatg
tatcatgcagaagtttttgccggtcttgaccctgaatttatggtgaaagtacatctactt
attccggaaggagaagaaaatattctgtataactggatgctcaacttccagtatatgtct
gacgaatatgcgaaaatgtataaagcttctaaaccaatcggcgatggaaaggaagctgat
atctatattttctctgatcctcagtggaacggttctgaccgtcccggagtcgatctgtcc
tgtttaagcgatccaaaatgtttatgctattttaatacggaccagaactgcgcggcaatc
ctgggtatgagatatttcggcgagcataaaaagggaacccttactatggtatgggctttg
gcaaaccgcaatggatatgcttcctgccacggcggacagaaagaatataacttaaccgat
ggatccaaatatgttgcatctgtatttggtttatccggctcaggaaaatccaccattacc
catgcaaagcatggcggaaaatatgatgttaccgttctccatgacgatgcatttattatc
aataccgacacttgctcatcggtagcaattgaaccaacatactttgataaaacacaggat
tatccgactggctgtgaagataataaatatcttttaactgcccagaactgctcctgcacc
ttagatgaagacggaaagatccagctggtaacagaggacatcagaaacggcaacggacgt
gccatcaaatcaaaactgtggtctcctaaccgtgtggataagattgatgctccggtcaat
gcgattttctggatcatgaaggatcctaccattccgccggtagtaaagttaaaaggcgct
tccctggcatctgttatgggcgcaacccttgcaacaaagagatcatcagcagaaagactg
gcaccgggagcggatcccaatgctctggtggttgtaccttatgccaacccattcagaacc
tatcctcttgccaatgactatgagaaatttaaaaagctggtagaagagaagaacgtagat
tgctatattatcaacactggtgatttcatgggtaaaaaggttcagccaaaggatacttta
ggcatcctggaagctattgtggataagaccgctcagttcaagcagtggggcccgttctct
gacattgaaatctttgagtgggaaggctttgttcctaaccttgatgatgccgcttatgcg
gagcagttaaaggcccgtatggaagaccgggtgaaattcgttgccaatactgcagtagtg
aaagaaggctatgacaagcttcctgatgatgctctggcagcacttgagaaaatcgttgca
gaattaaagtaa

DBGET integrated database retrieval system