KEGG   Clostridium saccharolyticum WM1: Closa_3183Help
Entry
Closa_3183        CDS       T01288                                 

Definition
(GenBank) 3,4-dihydroxy-2-butanone 4-phosphate synthase
  KO
K14652  3,4-dihydroxy 2-butanone 4-phosphate synthase / GTP cyclohydrolase II [EC:4.1.99.12 3.5.4.25]
Organism
csh  Clostridium saccharolyticum WM1
Pathway
csh00740  Riboflavin metabolism
csh00790  Folate biosynthesis
csh01100  Metabolic pathways
csh01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:csh00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00740 Riboflavin metabolism
    Closa_3183
   00790 Folate biosynthesis
    Closa_3183
Enzymes [BR:csh01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.4  In cyclic amidines
    3.5.4.25  GTP cyclohydrolase II
     Closa_3183
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.99  Other carbon-carbon lyases
    4.1.99.12  3,4-dihydroxy-2-butanone-4-phosphate synthase
     Closa_3183
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DHBP_synthase GTP_cyclohydro2
Motif
Other DBs
NCBI-ProteinID: ADL05713
UniProt: D9R8I4
Position
complement(3425156..3426355)
Genome map
AA seq 399 aa AA seqDB search
MFQYNPIEEALKALQQGKIILVTDNEGRENEGDLICAAQFATTENINFMATYGKGLICMP
MNGEICRRLNFPQMVSDNTDNHATAFTVSVDHVDTTTGISAAERSVTAMSCVAEEAKPED
FRRPGHMFPLLAKENGVLERDGHTEATVDLMRLAGLKECGLCCEIMSEDGTMMRKPQLIE
LAQKWNLPFITIAALQDYRKKNDRLVEQTSVSDMPTKYGDFKACCFVNRLNGEHHVALIK
GEIGDGQNILCRVHSECLTGDAFGSMRCDCGQQLAAAMTQIQKEGRGILLYMRQEGRGIG
LVNKLRAYALQDQGMDTLEANLALGFAGDPREYYIGAQILRELGVKTLRLITNNPEKVYG
LSGFGMEIIQRVPIQVPANEHDLFYLITKKNKMGHILHY
NT seq 1200 nt NT seq  +upstreamnt  +downstreamnt
atgtttcaatacaatcccattgaagaagcactgaaagcccttcaacaaggaaaaataatt
cttgtaacagataacgaaggcagggaaaatgaaggcgatttaatctgtgccgcccagttt
gcaacaacagaaaatattaacttcatggcaacctatggcaaaggattgatctgtatgccc
atgaacggagaaatttgcagacgccttaactttccccagatggtttctgataatactgat
aaccatgccaccgcattcactgtttcagtggatcatgtggataccactacaggaatatcc
gcggcggagcgctccgtcactgcaatgagctgtgtggctgaagaagcaaagccggaggat
ttccgccgtccgggacatatgttccccttgctggcaaaggaaaatggagttcttgagcgt
gacggacatacggaagccacggtagacctgatgcggctggcaggacttaaggaatgcggc
ctttgctgcgaaatcatgagcgaagacggtacaatgatgcgcaagccccagttgattgaa
ctggctcagaaatggaatcttccatttatcaccattgccgcattgcaggattaccggaaa
aaaaatgaccgtctggtggaacaaacctctgtcagcgatatgcccaccaaatacggcgat
tttaaggcctgctgcttcgtaaacaggctaaacggcgaacatcatgtggctcttatcaaa
ggtgaaatcggcgatgggcagaatatcctgtgccgtgtccattccgaatgtctgacagga
gacgccttcggttccatgcgatgcgactgcggacagcagcttgcagctgctatgacgcag
atccagaaggaaggcaggggcatcctcctctatatgcgtcaggaaggcaggggcatcggc
ctggtcaacaagctgcgtgcttatgctttgcaggatcaaggcatggacaccctggaggca
aaccttgcccttggctttgccggtgatccccgggaatattacattggcgctcagattctt
cgggaactgggagtcaaaaccctgcgcctgattaccaacaatccggaaaaggtctatggg
ctgtccgggtttggtatggaaattatccagcgagtccccattcaagtgccggcgaatgag
catgatttattttatctgataaccaagaagaacaaaatgggtcacattttacactattaa

DBGET integrated database retrieval system