KEGG   Clostridium saccharolyticum WM1: Closa_3201Help
Entry
Closa_3201        CDS       T01288                                 

Definition
(GenBank) Peroxiredoxin
  KO
K00432  glutathione peroxidase [EC:1.11.1.9]
Organism
csh  Clostridium saccharolyticum WM1
Pathway
csh00480  Glutathione metabolism
csh00590  Arachidonic acid metabolism
csh01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:csh00001]
 09100 Metabolism
  09103 Lipid metabolism
   00590 Arachidonic acid metabolism
    Closa_3201
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    Closa_3201
Enzymes [BR:csh01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     Closa_3201
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GSHPx AhpC-TSA Redoxin
Motif
Other DBs
NCBI-ProteinID: ADL05731
UniProt: D9R8K2
Position
complement(3445542..3446087)
Genome map
AA seq 181 aa AA seqDB search
MSVYDFTVKEMNGTEKHLSDYAGKVLLIVNSATICGFTPQYTDLQAMYDEYKGKGFEILD
FPCNQFGNQAPGENDEIHSFCTGRFGVTFPQFAKIDVNGENAIPLYRYLVNEKGFEGFDP
GHALTSRLEQKFEAVNPNYKKEPDIKWNFTKFLVDRQGNVVRRFEPTADRKAVEESVKNL
L
NT seq 546 nt NT seq  +upstreamnt  +downstreamnt
atgtctgtttatgattttacagtaaaggaaatgaatggtacagagaagcacttgtccgat
tatgcaggaaaggtgctgttgattgtaaattcggctacgatttgtgggtttactccccag
tatacggatcttcaggccatgtatgatgaatataaaggcaaaggatttgagattctggat
tttccctgtaaccagttcgggaaccaggctcccggcgaaaatgatgaaattcattccttt
tgtaccggacgctttggggttaccttccctcagtttgcaaagatcgacgtcaatggagag
aatgcgattcccctgtaccgttacctggtaaatgaaaaaggctttgagggctttgatccg
ggacatgccttaacttcccgtctggaacagaagtttgaagcggttaatcccaactacaaa
aaggaaccggatattaagtggaacttcaccaaattccttgtggaccgtcagggaaatgta
gtcaggcgttttgagcccactgccgataggaaggctgtggaggaaagtgtgaagaattta
ttatga

DBGET integrated database retrieval system