KEGG   Clostridium saccharolyticum WM1: Closa_3477Help
Entry
Closa_3477        CDS       T01288                                 

Definition
(GenBank) dTDP-4-dehydrorhamnose 35-epimerase related protein
  KO
K01790  dTDP-4-dehydrorhamnose 3,5-epimerase [EC:5.1.3.13]
Organism
csh  Clostridium saccharolyticum WM1
Pathway
csh00521  Streptomycin biosynthesis
csh00523  Polyketide sugar unit biosynthesis
csh01130  Biosynthesis of antibiotics
Module
csh_M00793  dTDP-L-rhamnose biosynthesis
Brite
KEGG Orthology (KO) [BR:csh00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00523 Polyketide sugar unit biosynthesis
    Closa_3477
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Closa_3477
Enzymes [BR:csh01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.13  dTDP-4-dehydrorhamnose 3,5-epimerase
     Closa_3477
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: dTDP_sugar_isom
Motif
Other DBs
NCBI-ProteinID: ADL06003
UniProt: D9RA31
Position
complement(3742076..3742639)
Genome map
AA seq 187 aa AA seqDB search
MAFTFEETQISGLFIVRPHYYQDDRGSNMKTFHKETFLEKGLKCDFGETMITTNLHKNVI
RGFHYQRPPYTQCKLYYCLCGEWNNYSVDLRKGSPTYGKVICISMNEEERKLLYIPEGIA
NAHLIKRDNTKVLYQLGSKYMPDHDEGVRWNSLGINFSVTNPIITDKDAGLPSFEEFESP
FIYGVNC
NT seq 564 nt NT seq  +upstreamnt  +downstreamnt
atggcatttacgtttgaagaaactcagatttctggactttttattgtaagacctcattat
tatcaggatgatagagggagcaatatgaagacgtttcacaaggaaacatttctggaaaaa
gggctaaaatgtgattttggtgaaaccatgattacgaccaaccttcataaaaatgttatc
cgtggttttcattatcaaagacctccctatacccagtgtaaattatattattgtctctgc
ggggaatggaataattactctgtagatttaagaaaaggctctcccacttatgggaaggta
atttgtatttctatgaatgaagaggaaagaaaacttctttacataccagaaggcattgca
aatgctcatttgattaagcgtgacaatacgaaggtgctgtatcagttgggttctaaatat
atgccggatcatgatgaaggggtccgctggaacagccttggaatcaatttttctgtaaca
aatcctattataacggataaggatgccggcctgccctcctttgaagaatttgaaagtcca
tttatatatggagtaaattgttaa

DBGET integrated database retrieval system