KEGG   Clostridium saccharolyticum WM1: Closa_4256Help
Entry
Closa_4256        CDS       T01288                                 

Definition
(GenBank) 3-octaprenyl-4-hydroxybenzoate carboxy-lyase
  KO
K03186  flavin prenyltransferase [EC:2.5.1.129]
Organism
csh  Clostridium saccharolyticum WM1
Pathway
csh00130  Ubiquinone and other terpenoid-quinone biosynthesis
csh00627  Aminobenzoate degradation
csh01100  Metabolic pathways
csh01110  Biosynthesis of secondary metabolites
csh01120  Microbial metabolism in diverse environments
csh01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:csh00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00130 Ubiquinone and other terpenoid-quinone biosynthesis
    Closa_4256
  09111 Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    Closa_4256
Enzymes [BR:csh01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.129  flavin prenyltransferase
     Closa_4256
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Flavoprotein
Motif
Other DBs
NCBI-ProteinID: ADL06757
UniProt: D9R3N6
Position
4606277..4606861
Genome map
AA seq 194 aa AA seqDB search
MKQYVVGITGASGSIYGLRTTEALLEAGARVRLILTGTGEKVVAYETGQEAGEWIAGFKK
RFPDQLIPEDNSDLFSASASGSHLADGMIIAPCSMSKLAHISAGITPDLMTRAADVALKQ
RRPLVLMPRETPLSQIHLKNMLALAECGAFIVPAMPAFYQKPKSLDDMADFMAGRVLDCL
GVENHRYARWKEEV
NT seq 585 nt NT seq  +upstreamnt  +downstreamnt
atgaaacaatatgtagttggaataacaggcgcaagcggcagtatttacggcctgcggaca
acggaggccctgcttgaggccggagccagagtgcggctcatactgaccggaaccggggaa
aaggtggttgcctacgagaccggacaggaagccggtgagtggatcgccggctttaagaaa
cgattcccggatcagcttattccggaagataacagtgatctgttttctgcgtctgccagc
ggttcccatctggcggatggaatgattattgccccttgctccatgtcaaaactggcccac
atttcggcaggcattacaccggatctgatgacacgggctgcggatgtggcactgaagcag
cgccgacctctggtgctgatgccaagggaaacccccctgtcccagatccatctgaaaaat
atgctggcactggcagagtgcggagcctttatcgtacccgccatgcccgccttctatcaa
aagccaaaaagccttgatgacatggcagatttcatggcaggccgggtattggactgcctg
ggagtggaaaaccaccggtatgccaggtggaaagaagaagtataa

DBGET integrated database retrieval system